SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g34301

Feature Type:gene_model
Chromosome:Gm14
Start:42760549
stop:42761112
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g34301
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80710AT Annotation by Michelle Graham. TAIR10: DROUGHT SENSITIVE 1 | chr1:30333499-30335796 REVERSE LENGTH=516 SoyBaseE_val: 5.00E-23ISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0080008GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
PTHR26208Panther FAMILY NOT NAMED JGI ISS
PTHR26208:SF50Panther JGI ISS
UniRef100_D7KX28UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transducin family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KX28_ARALL SoyBaseE_val: 7.00E-23ISS
UniRef100_I1LZM6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LZM6_SOYBN SoyBaseE_val: 8.00E-47ISS

Expression Patterns of Glyma14g34301
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g34301 not represented in the dataset
Glyma14g34301 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g34301 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g170000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g34301
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g34301
>Glyma14g34301.1   sequence type=CDS   gene model=Glyma14g34301   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGATGCAACTGTTATTAATCATAAGAATCAGACTGGCAGATGGCTTTCTACTTTCAGAGCAAAATGGGGTTGGGATGACTCATATCTCTTTGTTGGAAATTTGAAAAGAGGAGCTGATGTTGTCTCAACAGTTCAAAGGATGATGCTTATGACTCTAGAGAGCCAGCACATGTCTGCCATTCCTTGCAGATTTCATACACACTCTTACGAGGTTCGGATGCTAGTAGGAGCTACAAGTGGAGGCCAAATATAG
Predicted protein sequences of Glyma14g34301
>Glyma14g34301.1   sequence type=predicted peptide   gene model=Glyma14g34301   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEDATVINHKNQTGRWLSTFRAKWGWDDSYLFVGNLKRGADVVSTVQRMMLMTLESQHMSAIPCRFHTHSYEVRMLVGATSGGQI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo