Glyma14g34131 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g34131): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g34131): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g34131

Feature Type:	gene_model
Chromosome:	Gm14
Start:	42474421
stop:	42475484
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g34131

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G63280	AT	Annotation by Michelle Graham. TAIR10: C2H2-like zinc finger protein \| chr5:25367085-25368848 FORWARD LENGTH=271	SoyBase	E_val: 2.00E-34	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR21385	Panther	ZINC FINGER PROTEIN-RELATED	JGI		ISS
UniRef100_B6STE4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein n=1 Tax=Zea mays RepID=B6STE4_MAIZE	SoyBase	E_val: 1.00E-37	ISS
UniRef100_UPI000233B0B2	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233B0B2 related cluster n=1 Tax=unknown RepID=UPI000233B0B2	SoyBase	E_val: 1.00E-69	ISS

Expression Patterns of Glyma14g34131

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g34131 not represented in the dataset	Glyma14g34131 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g34131

Paralog	Evidence	Comments
Glyma13g02180	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g34131 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g168600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g34131

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g34131

Limit To All Plant Sequences

>Glyma14g34131.1   sequence type=CDS   gene model=Glyma14g34131   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGAGTCATGGTAAGTGCTTGGCTGATTTATGTGGGGCATTGCATTGTGATGCTGTGATGAATTTCAAATCCTCTAGAAGCAAGTGCAATCCGGTAGCTGCTGCAAGAAACCGTCGTCTATGTGAGAGTCTTGCTGACAACTGTTTTCCTATAAGTGAGGGTCCATCAGCAGGCTGCCTTCACGAATTATTTCTGCACCAAATTTGTGACACTTGCTCAGAGAAACATAAACCCTTCTCTAGAGGAGGCAAGGATCAAAGTAGTTTCTTCCGCCTGGCTGCTGGAGCATTGATCTTGGTGCTACTTCCTGTGTTCCAACTTTTTCTTTATTTGGTACAAAGTGACGTGAAGAGTTGA

Predicted protein sequences of Glyma14g34131

Limit To All Plant Sequences

>Glyma14g34131.1   sequence type=predicted peptide   gene model=Glyma14g34131   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQSHGKCLADLCGALHCDAVMNFKSSRSKCNPVAAARNRRLCESLADNCFPISEGPSAGCLHELFLHQICDTCSEKHKPFSRGGKDQSSFFRLAAGALILVLLPVFQLFLYLVQSDVKS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain