Glyma14g34080 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g34080): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g34080): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g34080

Feature Type:	gene_model
Chromosome:	Gm14
Start:	42435554
stop:	42436072
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g34080

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATCG00020	AT	Annotation by Michelle Graham. TAIR10: photosystem II reaction center protein A \| chrC:383-1444 REVERSE LENGTH=353	SoyBase	E_val: 2.00E-116	ISS
GO:0006091	GO-bp	Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy	SoyBase	N/A	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0009772	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem II	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0019684	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009523	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: photosystem II	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0010287	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0030076	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: light-harvesting complex	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0016168	GO-mf	Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding	SoyBase	N/A	ISS
GO:0045156	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	SoyBase	N/A	ISS
PF00124	PFAM	Photosynthetic reaction centre protein	JGI		ISS
UniRef100_I1MAQ2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1MAQ2_SOYBN	SoyBase	E_val: 9.00E-123	ISS
UniRef100_I1SZS9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Photosystem II D1 protein (Fragment) n=1 Tax=Damasonium californicum RepID=I1SZS9_9LILI	SoyBase	E_val: 9.00E-115	ISS

Expression Patterns of Glyma14g34080

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g34080 not represented in the dataset	Glyma14g34080 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g34080 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g34080

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g34080

Limit To All Plant Sequences

>Glyma14g34080.1   sequence type=CDS   gene model=Glyma14g34080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGTGCCATTATTCCTACTTCTGCGGCTATAGGTTTGCACTTTTATCCTATTTGGGAAGCGGCATCTATTGATGAATGGTTATATAACGGCGATCCTTATGAACTAATTGTTCTACACTTCTTACTTGGTGTAGCTTGCTACATGGGGCGTGAGTGGGAACTTAGTTTTCGTTTGGGTATGCGTCCTTCGATTGCTGTTGCATATTCAGCTCCTGTTGCAGCCGCTACTGCTGTTTTCTTTATCTATCCTATTGGTCAGGGAAGCTTTTCAGATGGTATGCCTCTAGGAATTTTAGGTACTTTCAATTTTATGATTGTATTTCAGGCTGAGCATAATATTCTTATGCATCCATTTCACATGTTAGGTGTAGCTGGTGTATTCGGCGGCTCCCTATTCAGTGATATGCATGGTTCCTTGGTAACTTCTTGTTTGATCAGGGAAACCACAGAAAATGAATCTGCTAATGAAGGTTACAGATTTGGTCAAGAGGAAGAAACCTATAATATTGTAGCTGCTCAT

Predicted protein sequences of Glyma14g34080

Limit To All Plant Sequences

>Glyma14g34080.1   sequence type=predicted peptide   gene model=Glyma14g34080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAIIPTSAAIGLHFYPIWEAASIDEWLYNGDPYELIVLHFLLGVACYMGREWELSFRLGMRPSIAVAYSAPVAAATAVFFIYPIGQGSFSDGMPLGILGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSDMHGSLVTSCLIRETTENESANEGYRFGQEEETYNIVAAH

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain