Glyma14g33886 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g33886): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g33886): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g33886

Feature Type:	gene_model
Chromosome:	Gm14
Start:	42253904
stop:	42254528
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g33886

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G36310	AT	Annotation by Michelle Graham. TAIR10: uridine-ribohydrolase 1 \| chr2:15224692-15226633 REVERSE LENGTH=336	SoyBase	E_val: 7.00E-47	ISS
GO:0006152	GO-bp	Annotation by Michelle Graham. GO Biological Process: purine nucleoside catabolic process	SoyBase	N/A	ISS
GO:0006218	GO-bp	Annotation by Michelle Graham. GO Biological Process: uridine catabolic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
GO:0045437	GO-mf	Annotation by Michelle Graham. GO Molecular Function: uridine nucleosidase activity	SoyBase	N/A	ISS
GO:0047622	GO-mf	Annotation by Michelle Graham. GO Molecular Function: adenosine nucleosidase activity	SoyBase	N/A	ISS
GO:0047724	GO-mf	Annotation by Michelle Graham. GO Molecular Function: inosine nucleosidase activity	SoyBase	N/A	ISS
GO:0072585	GO-mf	Annotation by Michelle Graham. GO Molecular Function: xanthosine nucleotidase activity	SoyBase	N/A	ISS
PTHR12304	Panther	INOSINE-URIDINE PREFERRING NUCLEOSIDE HYDROLASE	JGI		ISS
PF01156	PFAM	Inosine-uridine preferring nucleoside hydrolase	JGI		ISS
UniRef100_G7L609	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Inosine-uridine preferring ribonucleoside hydrolase n=1 Tax=Medicago truncatula RepID=G7L609_MEDTR	SoyBase	E_val: 2.00E-51	ISS
UniRef100_UPI000233BB10	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233BB10 related cluster n=1 Tax=unknown RepID=UPI000233BB10	SoyBase	E_val: 1.00E-72	ISS

Expression Patterns of Glyma14g33886

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g33886 not represented in the dataset	Glyma14g33886 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g33886 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g33886

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g33886

Limit To All Plant Sequences

>Glyma14g33886.1   sequence type=CDS   gene model=Glyma14g33886   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TGTGAGATCGCATGCCGTGAAAATATTTCAATTGCACAGGGAAGTCCTGAGCCGTTGAAGGGTGGAACGCCTTGTGTTGCTGATTTTGTTCATGGTAAAGATGGACTAGGGAACACATTCCTACCCCCACCTAAAGGTGAGAAAATTGAGAAGAGTGCTTGTGAGTTTTTGGTTGAGAAAGTCTCTGAATATCCCGGTGAAGTATCTGTGCTAGCACCTACCCCACTAACAAACGCAATCAAAGGAGATTTTGCGTTTGCAAGCAAAGTGAAGAGAATAGTTATACTTGGTGGTGCATTCTTTGCCTTGGGGAATGTGAATCCTGTTGCAGAAGCAAATGTAAGTGGTGGTTTCTGTAAGTTGAGTTTCTTTGAGTAG

Predicted protein sequences of Glyma14g33886

Limit To All Plant Sequences

>Glyma14g33886.1   sequence type=predicted peptide   gene model=Glyma14g33886   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CEIACRENISIAQGSPEPLKGGTPCVADFVHGKDGLGNTFLPPPKGEKIEKSACEFLVEKVSEYPGEVSVLAPTPLTNAIKGDFAFASKVKRIVILGGAFFALGNVNPVAEANVSGGFCKLSFFE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain