|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G21560 | AT | Annotation by Michelle Graham. TAIR10: UDP-Glycosyltransferase superfamily protein | chr3:7595884-7597374 FORWARD LENGTH=496 | SoyBase | E_val: 7.00E-21 | ISS |
GO:0009411 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to UV | SoyBase | N/A | ISS |
GO:0009718 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound biosynthetic process | SoyBase | N/A | ISS |
GO:0009801 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cinnamic acid ester metabolic process | SoyBase | N/A | ISS |
GO:0009813 | GO-bp | Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process | SoyBase | N/A | ISS |
GO:0080167 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to karrikin | SoyBase | N/A | ISS |
GO:0005575 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cellular component | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
GO:0008194 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: UDP-glycosyltransferase activity | SoyBase | N/A | ISS |
GO:0016758 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring hexosyl groups | SoyBase | N/A | ISS |
GO:0050284 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sinapate 1-glucosyltransferase activity | SoyBase | N/A | ISS |
UniRef100_B0I192 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative glycosyltransferase n=1 Tax=Clitoria ternatea RepID=B0I192_CLITE | SoyBase | E_val: 9.00E-26 | ISS |
UniRef100_B9RY85 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: UDP-glucosyltransferase, putative n=1 Tax=Ricinus communis RepID=B9RY85_RICCO | SoyBase | E_val: 2.00E-20 | ISS |
Glyma14g33715 not represented in the dataset |
Glyma14g33715 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.14g166400 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g33715.1 sequence type=CDS gene model=Glyma14g33715 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCGTCTAAAACTCTCATTCTCGTTCTTCTGGTATCATTCCCAGCACAAGGTCTCGTAAACCCTCTGCTGAGACTCGACAAGCACCTTGCTGCAAAAGGTTGCTTTGTCACCTTCTCCACTACAAAGCCCACCGGCGAACACATGCGCTTCGCCACCAACAACAATGCCACCATCGATGAAACCTCATCCACACCCATGGGCGACGGTTTCTTCGCCTTCAACTTCTTCGACGACAGTTTGGGCGACGGCGACCACCCAGAGAGGCATAATCTTTCAGACACCAAAGCCCATCTCGAGCGAATTGAAAGCAAGTCAGTTCCCAGATGA
>Glyma14g33715.1 sequence type=predicted peptide gene model=Glyma14g33715 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MASKTLILVLLVSFPAQGLVNPLLRLDKHLAAKGCFVTFSTTKPTGEHMRFATNNNATIDETSSTPMGDGFFAFNFFDDSLGDGDHPERHNLSDTKAHLERIESKSVPR*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||