SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g33227

Feature Type:gene_model
Chromosome:Gm14
Start:40821142
stop:40829202
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g33227
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G08640AT Annotation by Michelle Graham. TAIR10: flavonol synthase 1 | chr5:2804009-2805175 FORWARD LENGTH=336 SoyBaseE_val: 4.00E-64ISS
GO:0009411GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV SoyBaseN/AISS
GO:0009718GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound biosynthetic process SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009813GO-bp Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016706GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors SoyBaseN/AISS
GO:0045431GO-mf Annotation by Michelle Graham. GO Molecular Function: flavonol synthase activity SoyBaseN/AISS
PTHR10209Panther FE(II)/ ASCORBATE OXIDASE SUPERFAMILY JGI ISS
PTHR10209:SF55Panther OXIDOREDUCTASE, 2OG-FE(II) OXYGENASE FAMILY PROTEI JGI ISS
UniRef100_Q0EDG6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Flavonol synthase n=1 Tax=Glycine max RepID=Q0EDG6_SOYBN SoyBaseE_val: 1.00E-104ISS
UniRef100_UPI000233B996UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B996 related cluster n=1 Tax=unknown RepID=UPI000233B996 SoyBaseE_val: 3.00E-114ISS

Expression Patterns of Glyma14g33227
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g33227 not represented in the dataset
Glyma14g33227 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g33227
ParalogEvidenceComments
Glyma13g02740 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g33227 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g33227
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g33227
>Glyma14g33227.1   sequence type=CDS   gene model=Glyma14g33227   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGTGCTAAGGGTGCAAACCATAGCTTCCAAATCCAAAGATGCTGCCATCCCAGTCATGTTTGTTAGGGGAGAGACAGAGCAACCAGGCATCACAACTGTTCAAGGGGTGAACCTTGAGGTGCCAATTATTGACTTTAGTGACCCAGATGAAGGGAAAGGCATGTTCCAAATTGTGAACCATGAGATTCCCAGTGATGTGATTAGAAAGTTGCAAAATGTGGGCAAAGAGTTCTTTGAGTTGCCACAAGAGGAAAAAGAGTTGATTGCTAAACCTGCTGGTTCTGATTCTATTGAAGGGTATGGCACAAAGCTTCAGAAAGAGGTGAATGGCAAGAAAGGGTGGGTGGATCATTTGTTCCACACTGTGTGGCCACCTTCCTCCATTGACTACCGTTACTGGCCTAAGAACCCCCCTTCTTACAGGGAAGTGAATGAGGAATATTGCAGGTACCTACGAGGGGTGGTGGATAAATTGTTCAAAAGTATGTCAATAGGGTTG
Predicted protein sequences of Glyma14g33227
>Glyma14g33227.1   sequence type=predicted peptide   gene model=Glyma14g33227   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKVLRVQTIASKSKDAAIPVMFVRGETEQPGITTVQGVNLEVPIIDFSDPDEGKGMFQIVNHEIPSDVIRKLQNVGKEFFELPQEEKELIAKPAGSDSIEGYGTKLQKEVNGKKGWVDHLFHTVWPPSSIDYRYWPKNPPSYREVNEEYCRYLRGVVDKLFKSMSIGL






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo