SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g33130

Feature Type:gene_model
Chromosome:Gm14
Start:40576689
stop:40578306
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g33130
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G08240AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr4:5194713-5195756 FORWARD LENGTH=136 SoyBaseE_val: 1.00E-45ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1MAK5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MAK5_SOYBN SoyBaseE_val: 7.00E-99ISS

Expression Patterns of Glyma14g33130
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g33130
ParalogEvidenceComments
Glyma13g02790 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g33130 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g162600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g33130
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g33130
>Glyma14g33130.1   sequence type=CDS   gene model=Glyma14g33130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTATGAGAGGAATCGGAGGACCCCTTTTGTGCATCGGAGATCTCCTGAACGACGTCGGAGAAGAAGAACAACAACACGGACAAGGACACTCTCTCCTTCGCGAAACCTTTCCTTCTTCTTCCAATTTCAACTACAACGATCCACCCCCTGACCTCACCAAACTCTTCCAGGAACACTACGACCACTTGAATTCCGCACTCTCTGGCACCGACCACTCCTGGACCTCTCTCACCTTGAAGTTATGCACTGCACTAGAAACTTCAAATCAGCTGGTTCAATCTACCAACACAAATGTTGCATCCTTGTCAAAGAAGGTTGAGGACCTTCAGAAAATTGTTAAGAGAGGGGATTCTGCGATAGCAGCAGCGAAGGCACTTTATTATGTTACCCCAGACAATCACAGTAGTGCCTCAAAGTGA
Predicted protein sequences of Glyma14g33130
>Glyma14g33130.1   sequence type=predicted peptide   gene model=Glyma14g33130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSMRGIGGPLLCIGDLLNDVGEEEQQHGQGHSLLRETFPSSSNFNYNDPPPDLTKLFQEHYDHLNSALSGTDHSWTSLTLKLCTALETSNQLVQSTNTNVASLSKKVEDLQKIVKRGDSAIAAAKALYYVTPDNHSSASK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo