Glyma14g32976 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g32976

Feature Type:	gene_model
Chromosome:	Gm14
Start:	40064668
stop:	40065206
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g32976

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G62850	AT	Annotation by Michelle Graham. TAIR10: Class I peptide chain release factor \| chr1:23272608-23274211 REVERSE LENGTH=236	SoyBase	E_val: 5.00E-28	ISS
GO:0006415	GO-bp	Annotation by Michelle Graham. GO Biological Process: translational termination	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003747	GO-mf	Annotation by Michelle Graham. GO Molecular Function: translation release factor activity	SoyBase	N/A	ISS
UniRef100_B9RBS9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Immature colon carcinoma transcript, putative n=1 Tax=Ricinus communis RepID=B9RBS9_RICCO	SoyBase	E_val: 7.00E-29	ISS
UniRef100_B9RBS9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Immature colon carcinoma transcript, putative n=1 Tax=Ricinus communis RepID=B9RBS9_RICCO	SoyBase	E_val: 7.00E-29	ISS

Expression Patterns of Glyma14g32976

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g32976 not represented in the dataset	Glyma14g32976 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g32976 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g162500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g32976

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g32976

Limit To All Plant Sequences

>Glyma14g32976.1   sequence type=CDS   gene model=Glyma14g32976   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTGAACACCAAGGTGGACATGCGCTTCAATGTTAAAAATGCATATTGGTTGAATGACAGGATCAGGGACAAGATTTTGCAAACGGAGAAAAACCGTATTAACAAGGATAGGGAGCTTGTGATTTCTTCAACCAAGACTAGAACACAGAAGGGTAGCATTGAGGATGCTTTGACAAAGCTTCAGGTAGCACTGAAAAAATTACTATATAATTGTTTTTATTGA

Predicted protein sequences of Glyma14g32976

Limit To All Plant Sequences

>Glyma14g32976.1   sequence type=predicted peptide   gene model=Glyma14g32976   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VNTKVDMRFNVKNAYWLNDRIRDKILQTEKNRINKDRELVISSTKTRTQKGSIEDALTKLQVALKKLLYNCFY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain