SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g32701

Feature Type:gene_model
Chromosome:Gm14
Start:39935867
stop:39936259
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g32701
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G51010AT Annotation by Michelle Graham. TAIR10: Rubredoxin-like superfamily protein | chr5:20744615-20745344 FORWARD LENGTH=154 SoyBaseE_val: 6.00E-10ISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
UniRef100_B7FGQ5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Rubredoxin n=1 Tax=Medicago truncatula RepID=B7FGQ5_MEDTR SoyBaseE_val: 1.00E-14ISS
UniRef100_UPI000233E3E0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E3E0 related cluster n=1 Tax=unknown RepID=UPI000233E3E0 SoyBaseE_val: 2.00E-44ISS

Expression Patterns of Glyma14g32701
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g32701 not represented in the dataset
Glyma14g32701 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g32701 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g32701
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g32701
>Glyma14g32701.1   sequence type=CDS   gene model=Glyma14g32701   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATATGCAAGCACCCACAATCAGTCTTAACACTGCAAGGTCCCCATCTTCATTAGCTGCAGCTGCCAATGCTGGCCTGCGACCGCACCTCATCCCTATGGCTTTAAAGTCATCTTTCTTATGTAGTTCCCTTAACCTCTTACTTCATCCAATGCAACAATATCTTACTTCTGGAGCTCCCAGGATTTCAATGCGTGTGGCCTCCAAGCAAGCCTATATCTGTCGTGATTGTGGGATTCCTTTCATGTTTTGTCTCACCCTTTATCATTAG
Predicted protein sequences of Glyma14g32701
>Glyma14g32701.1   sequence type=predicted peptide   gene model=Glyma14g32701   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHMQAPTISLNTARSPSSLAAAANAGLRPHLIPMALKSSFLCSSLNLLLHPMQQYLTSGAPRISMRVASKQAYICRDCGIPFMFCLTLYH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo