SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g32465

Feature Type:gene_model
Chromosome:Gm14
Start:39749339
stop:39750040
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g32465
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G37990AT Annotation by Michelle Graham. TAIR10: ribosome biogenesis regulatory protein (RRS1) family protein | chr2:15900713-15903028 FORWARD LENGTH=318 SoyBaseE_val: 1.00E-15ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0000478GO-bp Annotation by Michelle Graham. GO Biological Process: endonucleolytic cleavage involved in rRNA processing SoyBaseN/AISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006406GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA export from nucleus SoyBaseN/AISS
GO:0006606GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus SoyBaseN/AISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
UniRef100_B9SEQ5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosome biogenesis regulatory protein, putative n=1 Tax=Ricinus communis RepID=B9SEQ5_RICCO SoyBaseE_val: 2.00E-18ISS
UniRef100_I1MAK2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MAK2_SOYBN SoyBaseE_val: 2.00E-52ISS

Expression Patterns of Glyma14g32465
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g32465 not represented in the dataset
Glyma14g32465 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g32465 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g32465
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g32465
>Glyma14g32465.1   sequence type=CDS   gene model=Glyma14g32465   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGTGAGAAACAACAAAAGTTTGATGTAGACCTCGACAACCTGATGGCTTTCGACTCCTATCACACCTTCCCTTCTCAACCATCTCTTTCCAGGGAGGACCTCATGAAGCAATGTTTACTAAAAGGCACTCACTTGGTTCAAGCTATTGCAGATGCCCTCTTTATCTTACCATCAACCGAAGATTTGGATGGACCCTTGTCACCTTGCCTCCCCCACTCACTCAATTGCTTAGAGAAAAACATTTGCCAAAACCAAAGCCTCCTACTGAATGGGAAGCTTTTGCCAAAAAGAAAGCTTTATGGTTATGAAATTTATTATAGCAGTAGGCAAATGCATACAGAATCAGAGGCACTGTAA
Predicted protein sequences of Glyma14g32465
>Glyma14g32465.1   sequence type=predicted peptide   gene model=Glyma14g32465   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGEKQQKFDVDLDNLMAFDSYHTFPSQPSLSREDLMKQCLLKGTHLVQAIADALFILPSTEDLDGPLSPCLPHSLNCLEKNICQNQSLLLNGKLLPKRKLYGYEIYYSSRQMHTESEAL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo