Report for Sequence Feature Glyma14g31410
Feature Type: gene_model
Chromosome: Gm14
Start: 38185251
stop: 38185491
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Expression Patterns of Glyma14g31410
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma14g31410 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma14g31410
Coding sequences of Glyma14g31410
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma14g31410.1 sequence type=CDS gene model=Glyma14g31410 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACAAATCCAAATCTAGAGTCATATTCAAGTTCGAACCAAAAAAGGAAACAAACCCAAAAACTGCAAAACCCAGATCTCGTCGGTGGCAGCGTTGATCCAGATCTCGTCGGT
Predicted protein sequences of Glyma14g31410
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma14g31410.1 sequence type=predicted peptide gene model=Glyma14g31410 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTNPNLESYSSSNQKRKQTQKLQNPDLVGGSVDPDLVG