SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g30375

Feature Type:gene_model
Chromosome:Gm14
Start:36952580
stop:36953452
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g30375
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G66580AT Annotation by Michelle Graham. TAIR10: senescence associated gene 24 | chr1:24839208-24840439 FORWARD LENGTH=221 SoyBaseE_val: 1.00E-45ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR11726Panther 60S RIBOSOMAL PROTEIN L10 JGI ISS
PTHR11726:SF10Panther JGI ISS
UniRef100_Q3SC85UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L10 n=1 Tax=Solanum lycopersicum RepID=Q3SC85_SOLLC SoyBaseE_val: 8.00E-45ISS
UniRef100_UPI000233ACBEUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233ACBE related cluster n=1 Tax=unknown RepID=UPI000233ACBE SoyBaseE_val: 2.00E-69ISS

Expression Patterns of Glyma14g30375
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g30375 not represented in the dataset
Glyma14g30375 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g30375 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g066100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g30375
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g30375
>Glyma14g30375.1   sequence type=CDS   gene model=Glyma14g30375   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTACTATGGTGTTTGATTTAGGACCTGCAAAGTGTTACCGACAAATTAAAAACAAGTCGTACTCGAAATCGCGGTTTTGCCACAGTGTTCCTGATCCTAAGACCAGGATTTATGATGTTGGCATGAAGAAGAAAGGTGTCGATGAGTTTCCTTTCTGTGTGCATTTGGTTAGTTGGGAGAAGGAGAATGTCTCGAGTGAGGCGCTGGAGGGTGCATTCCACTTGAGAGTCAGGGTGCATCCCTTCCATGTTCTTAGGATCAACAAAATGCTAGCTTCTTGGGTGCCATGGACCATTGGCTAA
Predicted protein sequences of Glyma14g30375
>Glyma14g30375.1   sequence type=predicted peptide   gene model=Glyma14g30375   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVTMVFDLGPAKCYRQIKNKSYSKSRFCHSVPDPKTRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEGAFHLRVRVHPFHVLRINKMLASWVPWTIG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo