|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT2G47610 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein | chr2:19529854-19531401 FORWARD LENGTH=257 | SoyBase | E_val: 3.00E-20 | ISS |
GO:0001510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA methylation | SoyBase | N/A | ISS |
GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
GO:0042254 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis | SoyBase | N/A | ISS |
GO:0005730 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleolus | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0005774 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane | SoyBase | N/A | ISS |
GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0022625 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit | SoyBase | N/A | ISS |
GO:0022626 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome | SoyBase | N/A | ISS |
GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
PTHR23105 | Panther | 60S RIBOSOMAL PROTEIN L10A - RELATED | JGI | ISS | |
PTHR23105:SF1 | Panther | 60S RIBOSOMAL PROTEIN L7A | JGI | ISS | |
PF01248 | PFAM | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family | JGI | ISS | |
UniRef100_I1MAH1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MAH1_SOYBN | SoyBase | E_val: 9.00E-44 | ISS |
UniRef100_Q2VCI3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L7A-like n=1 Tax=Solanum tuberosum RepID=Q2VCI3_SOLTU | SoyBase | E_val: 2.00E-18 | ISS |
Glyma14g29145 not represented in the dataset |
Glyma14g29145 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.14g124500 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g29145.1 sequence type=CDS gene model=Glyma14g29145 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTCCTAAACGAGGTGGAAAGGCTCCGACTCTTGCCGCTAAGAAGAAGCCTGAGAAGGTTTCGAATCCGTTGTTCGAGAAGCGTCCGAAGCAGGTTGTTGTGATTGCTCACGATGTGGACCCAATTGAATTGGTTGTCTGGCTTCCTGCACTGTACAGGAAGATGGAAATTCCGTATTGTATTGTGAAGGGAAAGGCCCGCTTGGGAACGAGAATACCAGAACTTTTGACTTGA
>Glyma14g29145.1 sequence type=predicted peptide gene model=Glyma14g29145 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAPKRGGKAPTLAAKKKPEKVSNPLFEKRPKQVVVIAHDVDPIELVVWLPALYRKMEIPYCIVKGKARLGTRIPELLT*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||