SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g28105

Feature Type:gene_model
Chromosome:Gm14
Start:34604240
stop:34606245
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g28105
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G10450AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L6 family | chr4:6463201-6464458 REVERSE LENGTH=194 SoyBaseE_val: 8.00E-12ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0015934GO-cc Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
GO:0019843GO-mf Annotation by Michelle Graham. GO Molecular Function: rRNA binding SoyBaseN/AISS
UniRef100_E5GBD5UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein l9 n=1 Tax=Cucumis melo subsp. melo RepID=E5GBD5_CUCME SoyBaseE_val: 3.00E-09ISS
UniRef100_I1MAF0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MAF0_SOYBN SoyBaseE_val: 6.00E-17ISS

Expression Patterns of Glyma14g28105
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g28105 not represented in the dataset
Glyma14g28105 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g28105 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g122100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g28105
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g28105
>Glyma14g28105.1   sequence type=CDS   gene model=Glyma14g28105   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGTAAAAGGAAGCTTAAGATTCGTGTACGCTCATTTTCCGATCAAAGCTAGCATTGGCAACAACAACAAGTCCATCAAGATCAGAAATTTCCTCGGCGAGAAGAAGAGACATGTAGGTGCTCGATCATATTTTGAAAAAAGGGAAGCTTCACTTGTATGGAGTTACAGACATGCAGGTATTGATTTGTTTTTAGGGAGACTATTATTTGTTTTGCCTGCTTGA
Predicted protein sequences of Glyma14g28105
>Glyma14g28105.1   sequence type=predicted peptide   gene model=Glyma14g28105   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVKGSLRFVYAHFPIKASIGNNNKSIKIRNFLGEKKRHVGARSYFEKREASLVWSYRHAGIDLFLGRLLFVLPA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo