SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g28071

Feature Type:gene_model
Chromosome:Gm14
Start:34499636
stop:34500078
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g28071
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G17790AT Annotation by Michelle Graham. TAIR10: VPS35 homolog A | chr2:7733685-7739344 FORWARD LENGTH=787 SoyBaseE_val: 4.00E-19ISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0042147GO-bp Annotation by Michelle Graham. GO Biological Process: retrograde transport, endosome to Golgi SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR11099Panther VACUOLAR SORTING PROTEIN 35 JGI ISS
PF03635PFAM Vacuolar protein sorting-associated protein 35 JGI ISS
UniRef100_G7JXK2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar protein sorting n=1 Tax=Medicago truncatula RepID=G7JXK2_MEDTR SoyBaseE_val: 3.00E-26ISS
UniRef100_I1LI35UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LI35_SOYBN SoyBaseE_val: 5.00E-30ISS

Expression Patterns of Glyma14g28071
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g28071 not represented in the dataset
Glyma14g28071 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g28071 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g121900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g28071
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g28071
>Glyma14g28071.1   sequence type=CDS   gene model=Glyma14g28071   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGCGTTGAAGCTTTCAAATTATCCTCGCGTAATAGAATACCTTCATATTCCGACTACGAAGGTCATGGCAACTGTTATTATTCAAAGCATTATGAAAAACGGAAAATGCATTTCTACTTCAGAAAAGGTTGAAGCATTGTTTGAACTGATAAAGGGGCTTATCAAGGATTCTGATGGGATCCCTAATGATGAGGTCATTTTAGTACCATGA
Predicted protein sequences of Glyma14g28071
>Glyma14g28071.1   sequence type=predicted peptide   gene model=Glyma14g28071   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIALKLSNYPRVIEYLHIPTTKVMATVIIQSIMKNGKCISTSEKVEALFELIKGLIKDSDGIPNDEVILVP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo