Glyma14g27705 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g27705

Feature Type:	gene_model
Chromosome:	Gm14
Start:	33915152
stop:	33915718
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g27705

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G01180	AT	Annotation by Michelle Graham. TAIR10: starch synthase 2 \| chr3:62456-65678 REVERSE LENGTH=792	SoyBase	E_val: 4.00E-32	ISS
GO:0001666	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hypoxia	SoyBase	N/A	ISS
GO:0010021	GO-bp	Annotation by Michelle Graham. GO Biological Process: amylopectin biosynthetic process	SoyBase	N/A	ISS
GO:0010264	GO-bp	Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process	SoyBase	N/A	ISS
GO:0019375	GO-bp	Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009011	GO-mf	Annotation by Michelle Graham. GO Molecular Function: starch synthase activity	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
PF08323	PFAM	Starch synthase catalytic domain	JGI		ISS
UniRef100_B9VJS6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Starch synthase IIa-1 n=1 Tax=Glycine max RepID=B9VJS6_SOYBN	SoyBase	E_val: 5.00E-33	ISS
UniRef100_I1LWK7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LWK7_SOYBN	SoyBase	E_val: 5.00E-33	ISS

Expression Patterns of Glyma14g27705

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g27705 not represented in the dataset	Glyma14g27705 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g27705 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g120500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g27705

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g27705

Limit To All Plant Sequences

>Glyma14g27705.1   sequence type=CDS   gene model=Glyma14g27705   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAAAATAGGAAATGACTATAGTAGATTTGTTGTTCCAGGAAATTTGACTAGCATAAGTTCTGCTTTCATGATCAAACAAAGATCCTTGCCATACCAGGCTCCTAATATGACAACATGGGGGCATCTCCATTTTCATTTGTCAGAGATTACTACTTTTGAATCTCTCCTAATAGTTCCTTGGCATGTTCCTTGTGGTGGAGTTTGCTATGGAGATGGAAATCAGGCCTTGATCGCAAATGATTGGCATACTGCTTTGCCGCCAGTGTATCTGAAAGCATATTATCGTGACCATGGTTTAATGAAGTACACAAGATCTGTTCTTGTGATTCATAACATAGCACACCAGGTTCATTCTCTATCTAGATATATAGTTAGTTCATTGTTGTGA

Predicted protein sequences of Glyma14g27705

Limit To All Plant Sequences

>Glyma14g27705.1   sequence type=predicted peptide   gene model=Glyma14g27705   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKIGNDYSRFVVPGNLTSISSAFMIKQRSLPYQAPNMTTWGHLHFHLSEITTFESLLIVPWHVPCGGVCYGDGNQALIANDWHTALPPVYLKAYYRDHGLMKYTRSVLVIHNIAHQVHSLSRYIVSSLL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain