|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G01180 | AT | Annotation by Michelle Graham. TAIR10: starch synthase 2 | chr3:62456-65678 REVERSE LENGTH=792 | SoyBase | E_val: 4.00E-32 | ISS |
| GO:0001666 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hypoxia | SoyBase | N/A | ISS |
| GO:0010021 | GO-bp | Annotation by Michelle Graham. GO Biological Process: amylopectin biosynthetic process | SoyBase | N/A | ISS |
| GO:0010264 | GO-bp | Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process | SoyBase | N/A | ISS |
| GO:0019375 | GO-bp | Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009011 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: starch synthase activity | SoyBase | N/A | ISS |
| GO:0016757 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups | SoyBase | N/A | ISS |
| PF08323 | PFAM | Starch synthase catalytic domain | JGI | ISS | |
| UniRef100_B9VJS6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Starch synthase IIa-1 n=1 Tax=Glycine max RepID=B9VJS6_SOYBN | SoyBase | E_val: 5.00E-33 | ISS |
| UniRef100_I1LWK7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LWK7_SOYBN | SoyBase | E_val: 5.00E-33 | ISS |
|
Glyma14g27705 not represented in the dataset |
Glyma14g27705 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.14g120500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g27705.1 sequence type=CDS gene model=Glyma14g27705 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTGAAAATAGGAAATGACTATAGTAGATTTGTTGTTCCAGGAAATTTGACTAGCATAAGTTCTGCTTTCATGATCAAACAAAGATCCTTGCCATACCAGGCTCCTAATATGACAACATGGGGGCATCTCCATTTTCATTTGTCAGAGATTACTACTTTTGAATCTCTCCTAATAGTTCCTTGGCATGTTCCTTGTGGTGGAGTTTGCTATGGAGATGGAAATCAGGCCTTGATCGCAAATGATTGGCATACTGCTTTGCCGCCAGTGTATCTGAAAGCATATTATCGTGACCATGGTTTAATGAAGTACACAAGATCTGTTCTTGTGATTCATAACATAGCACACCAGGTTCATTCTCTATCTAGATATATAGTTAGTTCATTGTTGTGA
>Glyma14g27705.1 sequence type=predicted peptide gene model=Glyma14g27705 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVKIGNDYSRFVVPGNLTSISSAFMIKQRSLPYQAPNMTTWGHLHFHLSEITTFESLLIVPWHVPCGGVCYGDGNQALIANDWHTALPPVYLKAYYRDHGLMKYTRSVLVIHNIAHQVHSLSRYIVSSLL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||