Glyma14g27640 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g27640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g27640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g27640

Feature Type:	gene_model
Chromosome:	Gm14
Start:	33893368
stop:	33894911
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g27640

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G03090	AT	Annotation by Michelle Graham. TAIR10: methylcrotonyl-CoA carboxylase alpha chain, mitochondrial / 3-methylcrotonyl-CoA carboxylase 1 (MCCA) \| chr1:739715-743819 FORWARD LENGTH=734	SoyBase	E_val: 5.00E-30	ISS
GO:0006552	GO-bp	Annotation by Michelle Graham. GO Biological Process: leucine catabolic process	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0009750	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004075	GO-mf	Annotation by Michelle Graham. GO Molecular Function: biotin carboxylase activity	SoyBase	N/A	ISS
GO:0004485	GO-mf	Annotation by Michelle Graham. GO Molecular Function: methylcrotonoyl-CoA carboxylase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016874	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ligase activity	SoyBase	N/A	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
GO:0050897	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cobalt ion binding	SoyBase	N/A	ISS
UniRef100_Q42777	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial n=1 Tax=Glycine max RepID=MCCA_SOYBN	SoyBase	E_val: 2.00E-79	ISS
UniRef100_UPI000233B557	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233B557 related cluster n=1 Tax=unknown RepID=UPI000233B557	SoyBase	E_val: 2.00E-175	ISS

Expression Patterns of Glyma14g27640

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g27640 not represented in the dataset	Glyma14g27640 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g27640 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g27640

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g27640

Limit To All Plant Sequences

>Glyma14g27640.1   sequence type=CDS   gene model=Glyma14g27640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CGAATCCTTAAACCAAGTGGGAGACTTGGACTTAGACTTGATGAAGTTACCATCTCCCTGCTTGTCCAATTACATGGATTTCCGCGCGCGCTCCACGCTGCTCCCGATGCTCCCAATGCCTTCGTTCACGACGTTTCAGCGCTCCACGACTTCCTCGCCGACACACGTAGGGACGATGCCACTGTTCAGGTCCCCGTCCCCAAGGTTCTGCCGCCACTTCCGCCTCCGTCCGACGCTCTTCCTCTTGGCCCTAATGCGCTCGATGAGTCCGCCTCCATGAAGGCCAAGCGCATTGCCCTCCAACGCAAGGGCGCCGCCGCCATGATCGCTGCCGAGGAGAGCTATTGTCGAATTTGCAAGTGTGGAGAAAATGAAGGAAGTGAGAAAGCTCAGAAGATGCTATCGTGCAAAAGTTGTGGCAAATTGAAAAAGAACATTCTATACACTCCTGGTAAATTGAAAAAGATGCTAGACGTGAAATGCCTCATTGAAAAAGAGCATTTCATATTGGCTAGAAATCCCCTTGGTAAATTGTCCCATTCTTGCTGTGTAATGTTGAGTTGTTTTTGGGGCAGCAGCTTGCTCCCTATATGGTATTCTACTCCACCTTTCAGAATCCATCATCAAGCTAAGCATAGAATGGAATTTGAGTGGGATAATGAATATGGTAGTGGTAGCTCAAAGATCATGAAGCTTACCATCACTTATCAGCCTGATGGTAGATACCTAATTGAGACAGAACATAATGGATCTCCTGTTTTAGAAGTGAAATCAACATATGTAAAAGATAACTATTTTAGAGTTGAAGCTGCTGGTGCAATCAATGATGTTAATGTAGCTGTTTATTCAAAGGCAAATATGGTTTTCCTTGGGATTCATGATCAAATAAGGCATATTCATATTTGGCAAGGGTCCTGTCATCATTATTTCAGAGAGAAACTAGGCCTG

Predicted protein sequences of Glyma14g27640

Limit To All Plant Sequences

>Glyma14g27640.1   sequence type=predicted peptide   gene model=Glyma14g27640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
RILKPSGRLGLRLDEVTISLLVQLHGFPRALHAAPDAPNAFVHDVSALHDFLADTRRDDATVQVPVPKVLPPLPPPSDALPLGPNALDESASMKAKRIALQRKGAAAMIAAEESYCRICKCGENEGSEKAQKMLSCKSCGKLKKNILYTPGKLKKMLDVKCLIEKEHFILARNPLGKLSHSCCVMLSCFWGSSLLPIWYSTPPFRIHHQAKHRMEFEWDNEYGSGSSKIMKLTITYQPDGRYLIETEHNGSPVLEVKSTYVKDNYFRVEAAGAINDVNVAVYSKANMVFLGIHDQIRHIHIWQGSCHHYFREKLGL

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain