SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g27625

Feature Type:gene_model
Chromosome:Gm14
Start:33869216
stop:33871849
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g27625
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G43600AT Annotation by Michelle Graham. TAIR10: ureidoglycolate amidohydrolase | chr5:17512651-17515280 FORWARD LENGTH=476 SoyBaseE_val: 1.00E-71ISS
GO:0000256GO-bp Annotation by Michelle Graham. GO Biological Process: allantoin catabolic process SoyBaseN/AISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009086GO-bp Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0004848GO-mf Annotation by Michelle Graham. GO Molecular Function: ureidoglycolate hydrolase activity SoyBaseN/AISS
GO:0008237GO-mf Annotation by Michelle Graham. GO Molecular Function: metallopeptidase activity SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
GO:0016813GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines SoyBaseN/AISS
PTHR11014Panther PROTEASE M20-RELATED JGI ISS
PTHR11014:SF27Panther SUBFAMILY NOT NAMED JGI ISS
PF01546PFAM Peptidase family M20/M25/M40 JGI ISS
UniRef100_G7I3Z0UniRef Annotation by Michelle Graham. Most informative UniRef hit: N-carbamoyl-L-amino acid hydrolase n=1 Tax=Medicago truncatula RepID=G7I3Z0_MEDTR SoyBaseE_val: 2.00E-91ISS
UniRef100_I1LC96UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LC96_SOYBN SoyBaseE_val: 1.00E-102ISS

Expression Patterns of Glyma14g27625
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g27625 not represented in the dataset
Glyma14g27625 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g27625 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g120400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g27625
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g27625
>Glyma14g27625.1   sequence type=CDS   gene model=Glyma14g27625   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTAAGTTTACTTTAGATATCATTTGGAGTAGAAATCATGTTGGTTTGGCTCCTTCTGAATTAGCCCTGGCTATAGAGAGGCATGTGTTGGATTGTGGTTCAATTGATAATGTTGGCACTGCCGGTATCTTGGAACTGCATCTTGGAGCAATCAACAACATCCCCAACAAATGTCACCTAGAAATTGACACAAGAGACATTGATGAGGAAAGAAGAAATAAAGTGGTTGACAAAATTCATCAATCAGCAATTAAAATAACCAAAACACGAGGTGTCAAGTTCTCTCATTTCCGTGTCATCAATCAGGATCCACTATCCCTTTCTAATGAAGCAGTCATGAAGGCAGTAGAGACTGCAACAAAAGAACTAAACTTGACAAGCAAGTTGATGATTAGTAGAGCCTATCATGATTCATTGCTTATGGCCAGGTTGTCTCCAATGGGCATGATTTTCATTCCATGGTACAAAGGGTACAACCATAAGCCTAAAGAGTTTGCCACCATTGAAGATATGTCAAATGGTGTAAACGTATCGGCGCTCACCCTAGCCAAATTGTCCAGTCAATAA
Predicted protein sequences of Glyma14g27625
>Glyma14g27625.1   sequence type=predicted peptide   gene model=Glyma14g27625   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIKFTLDIIWSRNHVGLAPSELALAIERHVLDCGSIDNVGTAGILELHLGAINNIPNKCHLEIDTRDIDEERRNKVVDKIHQSAIKITKTRGVKFSHFRVINQDPLSLSNEAVMKAVETATKELNLTSKLMISRAYHDSLLMARLSPMGMIFIPWYKGYNHKPKEFATIEDMSNGVNVSALTLAKLSSQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo