|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G27030 | AT | Annotation by Michelle Graham. TAIR10: TOPLESS-related 3 | chr5:9508913-9515263 REVERSE LENGTH=1108 | SoyBase | E_val: 9.00E-21 | ISS |
| GO:0010072 | GO-bp | Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| UniRef100_Q2HW32 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Lissencephaly type-1-like homology motif; CTLH, C-terminal to LisH motif; Nitrous oxide reductase, N-terminal; WD40-like; Quinonprotein alcohol dehydrogenase-like n=1 Tax=Medicago truncatula RepID=Q2HW32_MEDTR | SoyBase | E_val: 3.00E-30 | ISS |
| UniRef100_UPI000233DDD4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233DDD4 related cluster n=1 Tax=unknown RepID=UPI000233DDD4 | SoyBase | E_val: 4.00E-32 | ISS |
|
Glyma14g27180 not represented in the dataset |
Glyma14g27180 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g27180.1 sequence type=CDS gene model=Glyma14g27180 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGACATTGCATCAAGGATCCTCTATGACGAGCATAGATTTCCATCCTTCTCGTCATACCTTACTTATTGTTATTGTTTATCATGCTGGTTCAAATAATGGAGAAACTAGCCTCTGGGAACTCAGTTTGCGAGAAAAGTTGGTTTCAGAGCCATTCAAGATATGGGATGTGGTTGCATGCTCATTACCATTTCAGGTTTCATACATTGAGAATTTTTCAGGCTGCTGCATGAGCCCTGATGGAAGTTTTGTGGGTATGTTACTTCATGCTTCTTATATTATTTTATTTAATATATTTTGTATATTTAAAATTTAG
>Glyma14g27180.1 sequence type=predicted peptide gene model=Glyma14g27180 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MTLHQGSSMTSIDFHPSRHTLLIVIVYHAGSNNGETSLWELSLREKLVSEPFKIWDVVACSLPFQVSYIENFSGCCMSPDGSFVGMLLHASYIILFNIFCIFKI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||