Glyma14g27180 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g27180

Feature Type:	gene_model
Chromosome:	Gm14
Start:	33244974
stop:	33245553
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g27180

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G27030	AT	Annotation by Michelle Graham. TAIR10: TOPLESS-related 3 \| chr5:9508913-9515263 REVERSE LENGTH=1108	SoyBase	E_val: 9.00E-21	ISS
GO:0010072	GO-bp	Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
UniRef100_Q2HW32	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Lissencephaly type-1-like homology motif; CTLH, C-terminal to LisH motif; Nitrous oxide reductase, N-terminal; WD40-like; Quinonprotein alcohol dehydrogenase-like n=1 Tax=Medicago truncatula RepID=Q2HW32_MEDTR	SoyBase	E_val: 3.00E-30	ISS
UniRef100_UPI000233DDD4	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DDD4 related cluster n=1 Tax=unknown RepID=UPI000233DDD4	SoyBase	E_val: 4.00E-32	ISS

Expression Patterns of Glyma14g27180

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g27180 not represented in the dataset	Glyma14g27180 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g27180 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g27180

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g27180

Limit To All Plant Sequences

>Glyma14g27180.1   sequence type=CDS   gene model=Glyma14g27180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACATTGCATCAAGGATCCTCTATGACGAGCATAGATTTCCATCCTTCTCGTCATACCTTACTTATTGTTATTGTTTATCATGCTGGTTCAAATAATGGAGAAACTAGCCTCTGGGAACTCAGTTTGCGAGAAAAGTTGGTTTCAGAGCCATTCAAGATATGGGATGTGGTTGCATGCTCATTACCATTTCAGGTTTCATACATTGAGAATTTTTCAGGCTGCTGCATGAGCCCTGATGGAAGTTTTGTGGGTATGTTACTTCATGCTTCTTATATTATTTTATTTAATATATTTTGTATATTTAAAATTTAG

Predicted protein sequences of Glyma14g27180

Limit To All Plant Sequences

>Glyma14g27180.1   sequence type=predicted peptide   gene model=Glyma14g27180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTLHQGSSMTSIDFHPSRHTLLIVIVYHAGSNNGETSLWELSLREKLVSEPFKIWDVVACSLPFQVSYIENFSGCCMSPDGSFVGMLLHASYIILFNIFCIFKI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain