SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g27125): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g27125): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g27125

Feature Type:gene_model
Chromosome:Gm14
Start:33239904
stop:33240539
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g27125
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G34860AT Annotation by Michelle Graham. TAIR10: DnaJ/Hsp40 cysteine-rich domain superfamily protein | chr2:14708380-14709804 FORWARD LENGTH=186 SoyBaseE_val: 1.00E-25ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0009561GO-bp Annotation by Michelle Graham. GO Biological Process: megagametogenesis SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010304GO-bp Annotation by Michelle Graham. GO Biological Process: PSII associated light-harvesting complex II catabolic process SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042793GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0031072GO-mf Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding SoyBaseN/AISS
GO:0051082GO-mf Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding SoyBaseN/AISS
UniRef100_O64750UniRef Annotation by Michelle Graham. Most informative UniRef hit: Embryo sac development arrest 3 protein n=1 Tax=Arabidopsis thaliana RepID=O64750_ARATH SoyBaseE_val: 6.00E-23ISS
UniRef100_UPI000233B551UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B551 related cluster n=1 Tax=unknown RepID=UPI000233B551 SoyBaseE_val: 1.00E-81ISS

Expression Patterns of Glyma14g27125
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g27125 not represented in the dataset
Glyma14g27125 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g27125 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g27125
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g27125
>Glyma14g27125.1   sequence type=CDS   gene model=Glyma14g27125   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTCTCGTGTTTCTGTTCGACTCTAGTTTTGATTAGTGATTGCGCCATGCCTATTTTTGTACCAAAGGCATCCGCTGTGAATGGAATGATGGATAAACCTTTGTGCAGAAATTGTTTGGGAAGTGGTGCTGTGCTTTATGATATGTGTGGTGGCACAGGAAAATGGAAAGCTCTTAACATGAAGCGAGCTAAAGATGTTTACGAATTTACTGAGTGTCCAAATTGTTATGGTATGAACTCCAGTTTCTACTTGACTCCATTTTTGTTAGCTATAAGAGGTGATGATAATGGCATGGTTTATTCGAAGCACTTTTTAAGTAGCTGTTCTGAATGGCCTTTGTTGACATGCTTTTCTGTTAGGTAA
Predicted protein sequences of Glyma14g27125
>Glyma14g27125.1   sequence type=predicted peptide   gene model=Glyma14g27125   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LSCFCSTLVLISDCAMPIFVPKASAVNGMMDKPLCRNCLGSGAVLYDMCGGTGKWKALNMKRAKDVYEFTECPNCYGMNSSFYLTPFLLAIRGDDNGMVYSKHFLSSCSEWPLLTCFSVR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo