|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G15420 | AT | Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Small-subunit processome, Utp12 (InterPro:IPR007148); Has 764 Blast hits to 656 proteins in 193 species: Archae - 0; Bacteria - 42; Metazoa - 237; Fungi - 154; Plants - 85; Viruses - 23; Other Eukaryotes - 223 (source: NCBI BLink). | chr1:5301794-5303296 REVERSE LENGTH=278 | SoyBase | E_val: 2.00E-14 | ISS |
| GO:0006626 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion | SoyBase | N/A | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| UniRef100_Q9XI26 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: F9L1.38 n=1 Tax=Arabidopsis thaliana RepID=Q9XI26_ARATH | SoyBase | E_val: 8.00E-12 | ISS |
| UniRef100_UPI000233AB53 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233AB53 related cluster n=1 Tax=unknown RepID=UPI000233AB53 | SoyBase | E_val: 5.00E-36 | ISS |
|
Glyma14g26830 not represented in the dataset |
Glyma14g26830 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.14g118600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g26830.1 sequence type=CDS gene model=Glyma14g26830 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGGAGAGAAACTTGCTAGTCTAAGTGTTCTGGATGGGAACAAATCAAGGAGTGATATAGAGCAAGAATCTTCTGTCCCAACAAAGCCTCCAAGTGCAGACTCTGTATATGTTTTGCTTAAGCAAGCATTAAATGCTGATGATCGCACCCTTCTGCTAGATTGCTTGTTTACACAAAATGAGAAGGATTTGTCTATTATATAA
>Glyma14g26830.1 sequence type=predicted peptide gene model=Glyma14g26830 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MGEKLASLSVLDGNKSRSDIEQESSVPTKPPSADSVYVLLKQALNADDRTLLLDCLFTQNEKDLSII*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||