Report for Sequence Feature Glyma14g26690
Feature Type: gene_model
Chromosome: Gm14
Start: 32741874
stop: 32751571
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma14g26690
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G43890 AT
Annotation by Michelle Graham. TAIR10: RAB GTPASE HOMOLOG B18 | chr1:16646934-16648395 FORWARD LENGTH=212
SoyBase E_val: 7.00E-130 ISS
GO:0007264 GO-bp
Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction
SoyBase N/A ISS
GO:0015031 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein transport
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0005525 GO-mf
Annotation by Michelle Graham. GO Molecular Function: GTP binding
SoyBase N/A ISS
KOG0080
KOG
GTPase Rab18, small G protein superfamily
JGI ISS
PTHR24073 Panther
FAMILY NOT NAMED
JGI ISS
PTHR24073:SF482 Panther
JGI ISS
PF00071 PFAM
Ras family
JGI ISS
UniRef100_B9S2N7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Protein phosphatase 2c, putative n=1 Tax=Ricinus communis RepID=B9S2N7_RICCO
SoyBase E_val: 5.00E-129 ISS
UniRef100_C6TJB7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TJB7_SOYBN
SoyBase E_val: 6.00E-154 ISS
Expression Patterns of Glyma14g26690
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma14g26690
Paralog Evidence Comments
Glyma13g09260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma14g26690 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.14g118400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma14g26690
Coding sequences of Glyma14g26690
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma14g26690.1 sequence type=CDS gene model=Glyma14g26690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGATGCTTCATCTTCCTCGTCGAGTCAACCTGAATTCGATTACTTGTTCAAGCTTCTCTTGATTGGGGATTCTGGGGTTGGCAAAAGCACCCTGCTTTTGAGCTTCACCTCCGATACCTTCGAGGATCTTTCTCCCACCATCGGTGTAGATTTCAAAGTTAAATATGTTACAATTGGAGGGAAAAAGTTAAAACTTGCTATTTGGGACACAGCTGGGCAGGAAAGGTTTAGAACACTTACTAGTTCATATTACAGAGGAGCACAAGGAATAATTATGGTATATGATGTAACAAGGCGGGAAACCTTTACAAATCTATCTGATATATGGGCTAAAGAAATTGACTTATACTCAACAAATCAAGATTGCATCAAGATGCTTGTTGGAAACAAAGTTGATAAGGAAAGTGAAAGGGTTGTCAGCAAAAAGGAAGGAATAGACTTTGCTAGGGAATATGGTTGTCTGTATACTGAATGCAGTGCAAAAACCAGAGTCAATGTTACACAGTGTTTTGATGAGCTTGTGATGAAGATTTTGGAGACACCAAGCCTCTTGGCTGAGGGCTCATCTGGTGTGAAAAAGAACATCTTCAAGCAGAAACCCCCACTGTCTGATGCATCAAGTAGTGGCTGCTGCTCATGGTAA
Predicted protein sequences of Glyma14g26690
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma14g26690.1 sequence type=predicted peptide gene model=Glyma14g26690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MDASSSSSSQPEFDYLFKLLLIGDSGVGKSTLLLSFTSDTFEDLSPTIGVDFKVKYVTIGGKKLKLAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRETFTNLSDIWAKEIDLYSTNQDCIKMLVGNKVDKESERVVSKKEGIDFAREYGCLYTECSAKTRVNVTQCFDELVMKILETPSLLAEGSSGVKKNIFKQKPPLSDASSSGCCSW*