Glyma14g26460 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g26460

Feature Type:	gene_model
Chromosome:	Gm14
Start:	32514967
stop:	32517062
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g26460

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G27700	AT	Annotation by Michelle Graham. TAIR10: Rhodanese/Cell cycle control phosphatase superfamily protein \| chr4:13826541-13827673 REVERSE LENGTH=224	SoyBase	E_val: 1.00E-78	ISS
GO:0000023	GO-bp	Annotation by Michelle Graham. GO Biological Process: maltose metabolic process	SoyBase	N/A	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0007568	GO-bp	Annotation by Michelle Graham. GO Biological Process: aging	SoyBase	N/A	ISS
GO:0019252	GO-bp	Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process	SoyBase	N/A	ISS
GO:0043085	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF00581	PFAM	Rhodanese-like domain	JGI		ISS
UniRef100_G7J862	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Senescence-associated protein DIN1 n=1 Tax=Medicago truncatula RepID=G7J862_MEDTR	SoyBase	E_val: 2.00E-93	ISS
UniRef100_I1MAC6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MAC6_SOYBN	SoyBase	E_val: 2.00E-143	ISS

Expression Patterns of Glyma14g26460

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g26460 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g118100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g26460

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g26460

Limit To All Plant Sequences

>Glyma14g26460.1   sequence type=CDS   gene model=Glyma14g26460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGTTTTTGCATCTTCATCATCTTTACAAACCCATTTGCATTCCTCGCTCTTGGCACCTTCTTTTGAAGGTGCACATGATCACAACTCGTGGTGGGTGCGAGCGAGATCACAGAAACGCATTGGTCAAAGATTACACACACAGGACATAGCTAGAGGGCTGAGAATAAAAGTCCAGAGTGCAGCAACAAAACCAGCAAAATCTCCAGCTGAAGAAGATTGGAAGGTTAAGCGAGAATTTCTGCTTCAGAAAAGGGTAAGAAGTGTGGAAGTAAAGGAAGCTCTGCGCCTTCAGAAAGAAAACAGTTTTGTATTACTTGATGTAAGACCAGAAGCAGAGTTCAAGGAGGCACATCCTCCAGGTGCAATCAATGTGCAAATATATAGGCTCATAAAAGAGTGGACAGCATGGGACATTGCAAGACGTGCTGCATTTTTGTTTTTTGGTATTTTTTCTGGGACAGAAGAGAACCCTGAGTTCATCAAGAATGTTGAAGCAAAAATAGATAAAGATGCAAAGATAATAGTAGCTTGCACATCAGGGGGTACATTGAGACCATCACAAAATTTGCCCGAAGGTCAACAATCAAGGTACTAA

Predicted protein sequences of Glyma14g26460

Limit To All Plant Sequences

>Glyma14g26460.1   sequence type=predicted peptide   gene model=Glyma14g26460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVFASSSSLQTHLHSSLLAPSFEGAHDHNSWWVRARSQKRIGQRLHTQDIARGLRIKVQSAATKPAKSPAEEDWKVKREFLLQKRVRSVEVKEALRLQKENSFVLLDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWDIARRAAFLFFGIFSGTEENPEFIKNVEAKIDKDAKIIVACTSGGTLRPSQNLPEGQQSRY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain