Glyma14g26450 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g26450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g26450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g26450

Feature Type:	gene_model
Chromosome:	Gm14
Start:	32499282
stop:	32499395
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g26450

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G27700	AT	Annotation by Michelle Graham. TAIR10: Rhodanese/Cell cycle control phosphatase superfamily protein \| chr4:13826541-13827673 REVERSE LENGTH=224	SoyBase	E_val: 3.00E-13	ISS
GO:0000023	GO-bp	Annotation by Michelle Graham. GO Biological Process: maltose metabolic process	SoyBase	N/A	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0007568	GO-bp	Annotation by Michelle Graham. GO Biological Process: aging	SoyBase	N/A	ISS
GO:0019252	GO-bp	Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process	SoyBase	N/A	ISS
GO:0043085	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_G7J862	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Senescence-associated protein DIN1 n=1 Tax=Medicago truncatula RepID=G7J862_MEDTR	SoyBase	E_val: 5.00E-15	ISS
UniRef100_UPI000233AB4E	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233AB4E related cluster n=1 Tax=unknown RepID=UPI000233AB4E	SoyBase	E_val: 1.00E-17	ISS

Expression Patterns of Glyma14g26450

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g26450 not represented in the dataset	Glyma14g26450 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g26450 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g26450

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g26450

Limit To All Plant Sequences

>Glyma14g26450.1   sequence type=CDS   gene model=Glyma14g26450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCACTTATAGCAGCGTACCTGTTGGTCCTTAACGGTTATACCAATGTCTTTCATCTAGAAGGTGGATTGTACAAATGGTTCAAAGAGGAACTGCCAACTGTTTCAGAGGAGTGA

Predicted protein sequences of Glyma14g26450

Limit To All Plant Sequences

>Glyma14g26450.1   sequence type=predicted peptide   gene model=Glyma14g26450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SLIAAYLLVLNGYTNVFHLEGGLYKWFKEELPTVSEE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain