SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g26450

Feature Type:gene_model
Chromosome:Gm14
Start:32499282
stop:32499395
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g26450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G27700AT Annotation by Michelle Graham. TAIR10: Rhodanese/Cell cycle control phosphatase superfamily protein | chr4:13826541-13827673 REVERSE LENGTH=224 SoyBaseE_val: 3.00E-13ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0007568GO-bp Annotation by Michelle Graham. GO Biological Process: aging SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7J862UniRef Annotation by Michelle Graham. Most informative UniRef hit: Senescence-associated protein DIN1 n=1 Tax=Medicago truncatula RepID=G7J862_MEDTR SoyBaseE_val: 5.00E-15ISS
UniRef100_UPI000233AB4EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233AB4E related cluster n=1 Tax=unknown RepID=UPI000233AB4E SoyBaseE_val: 1.00E-17ISS

Expression Patterns of Glyma14g26450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g26450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g26450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g26450
>Glyma14g26450.1   sequence type=CDS   gene model=Glyma14g26450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCACTTATAGCAGCGTACCTGTTGGTCCTTAACGGTTATACCAATGTCTTTCATCTAGAAGGTGGATTGTACAAATGGTTCAAAGAGGAACTGCCAACTGTTTCAGAGGAGTGA
Predicted protein sequences of Glyma14g26450
>Glyma14g26450.1   sequence type=predicted peptide   gene model=Glyma14g26450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SLIAAYLLVLNGYTNVFHLEGGLYKWFKEELPTVSEE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo