|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G19330 | AT | Annotation by Michelle Graham. TAIR10: ARM repeat protein interacting with ABF2 | chr5:6508095-6512701 REVERSE LENGTH=710 | SoyBase | E_val: 1.00E-20 | ISS |
GO:0000956 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nuclear-transcribed mRNA catabolic process | SoyBase | N/A | ISS |
GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
GO:0009737 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus | SoyBase | N/A | ISS |
GO:0010187 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of seed germination | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
UniRef100_G7IE13 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Speckle-type POZ protein-like protein n=1 Tax=Medicago truncatula RepID=G7IE13_MEDTR | SoyBase | E_val: 5.00E-26 | ISS |
UniRef100_I1MAA7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MAA7_SOYBN | SoyBase | E_val: 3.00E-73 | ISS |
Glyma14g25570 not represented in the dataset |
Glyma14g25570 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g25570.1 sequence type=CDS gene model=Glyma14g25570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GCAATTGTAGAAGAATTCCTGCAGAATTTGGCAGCTCTAACTGTTATTCTTGATCTAAACAAGTTATTAATTTTATTAATGGAAAGTGCATATCTAAGCTTTGACAACTCAATTTCACCTTATCCTCTAGATATATCACTGGAGAATGTGTCCAGTATTTATGAACTTTTAGAGGCCTTTAACACTTTATCATTGAGGCACACAAGCATCCTTTTTATCTTGGAGCACTATGATAAATTGAGTGGAAAGCCAGGACACTCTCATCTGATTCAGCGTATAATACCCAAGATTCAGAATTACTTTGTTAAAGCCCTTACCAAGGCCAATTCCAACATCTTGCCGTAA
>Glyma14g25570.1 sequence type=predicted peptide gene model=Glyma14g25570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high AIVEEFLQNLAALTVILDLNKLLILLMESAYLSFDNSISPYPLDISLENVSSIYELLEAFNTLSLRHTSILFILEHYDKLSGKPGHSHLIQRIIPKIQNYFVKALTKANSNILP*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||