|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G38130 | AT | Annotation by Michelle Graham. TAIR10: histone deacetylase 1 | chr4:17896663-17899057 REVERSE LENGTH=469 | SoyBase | E_val: 2.00E-29 | ISS |
| GO:0009294 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA mediated transformation | SoyBase | N/A | ISS |
| GO:0009405 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pathogenesis | SoyBase | N/A | ISS |
| GO:0009861 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid and ethylene-dependent systemic resistance | SoyBase | N/A | ISS |
| GO:0016573 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone acetylation | SoyBase | N/A | ISS |
| GO:0016575 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone deacetylation | SoyBase | N/A | ISS |
| GO:0045892 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:2000026 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of multicellular organismal development | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0004407 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: histone deacetylase activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PTHR10625 | Panther | HISTONE DEACETYLASE | JGI | ISS | |
| UniRef100_I1LWR2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Histone deacetylase n=1 Tax=Glycine max RepID=I1LWR2_SOYBN | SoyBase | E_val: 8.00E-34 | ISS |
| UniRef100_I1LWR2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Histone deacetylase n=1 Tax=Glycine max RepID=I1LWR2_SOYBN | SoyBase | E_val: 8.00E-34 | ISS |
|
Glyma14g25215 not represented in the dataset |
Glyma14g25215 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.14g157100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g25215.1 sequence type=CDS gene model=Glyma14g25215 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCCACAGCACAAGTACTATGAATATTTTGGTCCAGATTATACCCTTCATGTTGGCCCAAGTAACATGGAAAACAAGAATTCCCGTCATTTACTTGAAGAAATTAGATCTAAACTATGTGAAAATCTTTCCAAGCTGCAACATGCTCCTAGTGTCCAATTTCAGGAAAGACCTCTTGATTCTGATCTTGGAGAGGTAAACCTCTACTGCCTTATATTTTACTTTATAGGAGTATAA
>Glyma14g25215.1 sequence type=predicted peptide gene model=Glyma14g25215 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MPQHKYYEYFGPDYTLHVGPSNMENKNSRHLLEEIRSKLCENLSKLQHAPSVQFQERPLDSDLGEVNLYCLIFYFIGV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||