Glyma14g24424 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g24424): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g24424): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g24424

Feature Type:	gene_model
Chromosome:	Gm14
Start:	29320646
stop:	29322268
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g24424

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G35100	AT	Annotation by Michelle Graham. TAIR10: plasma membrane intrinsic protein 3 \| chr4:16708672-16709958 FORWARD LENGTH=280	SoyBase	E_val: 5.00E-73	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0006833	GO-bp	Annotation by Michelle Graham. GO Biological Process: water transport	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0046658	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0015250	GO-mf	Annotation by Michelle Graham. GO Molecular Function: water channel activity	SoyBase	N/A	ISS
KOG0223	KOG	Aquaporin (major intrinsic protein family)	JGI		ISS
PTHR19139	Panther	AQUAPORIN TRANSPORTER	JGI		ISS
PTHR19139:SF50	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00230	PFAM	Major intrinsic protein	JGI		ISS
UniRef100_I1JSD5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSD5_SOYBN	SoyBase	E_val: 5.00E-80	ISS
UniRef100_Q5DVT5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Plasma membrane intrinsic protein 2;5 n=1 Tax=Mimosa pudica RepID=Q5DVT5_MIMPU	SoyBase	E_val: 6.00E-76	ISS

Expression Patterns of Glyma14g24424

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g24424 not represented in the dataset	Glyma14g24424 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g24424 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g153900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g24424

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma14g24424

Limit To All Plant Sequences

>Glyma14g24424.2   sequence type=transcript   gene model=Glyma14g24424   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAATAATTATAAATTTTAAAAAATGGTTCTTAAAGAACCGACATAGAATCCGACAATACAATGCGAAGTGACTCTCTCTCACTCCTTATTTTCATCTTTTTAATCTCCCTCTCCAGTTTTAGAATATCCTAAATTCCTCCCTAGCCCACACTCACAATGCAGTCCACACTCTCCAATTTCATTTTTCACCGCCATAACCGAAACGAGCCTGGTGTCAGGCTTAATCGTGCCAATGAGGGATGAAGATGTTGACGTCTTGGTACCTTTTTTCACTCAATTTATATTTTAATTGTTCTATGTTAGTGGTACCTTCTCGGAATTCTCTGCGGCCTTCCCCACCGTAATAGAGAACCCAACAGCATGCCTTAAAGAGGCAGAGCCTGAACCGGAAATCCCGGTTTTCTCTTTCAAAACCCCGGTTCAGACCAAAGCAAGAAGCAAGCAAACCAGAAACGGTCTTCGTGTTTGGCCATTCCGTTCACCTTCCTTCACCAATTCTTCCTCAAGCTCCACCACATCTTTCTCTTCCTCTTTCTCAGCTTCTAGCCCCTTACTAATTTATAGCCAAAGCCTTCGGTGGCATGATCTTTGTCCTCGTCTACTACACCGTCGGCATTTCTGGTGGACACATTAACACTGCCGTGACTTTTGGCCTGTTCCTGGCATGCAAGGTGTCTCTCATTCGTGCCATGTTCTACATGGTAGCACATTGTTTGGGTGCTATCTGCGGTTTTGGGTTGGTGAAGGCCTTCATGAAGCACTCCTACAACTCCCTCGGCGGTGGTGCTAACTCCGTTAGCGCTGCCTACAACAAAGGCAGTGCTCTGGGTGCGGAGATCATCGACACTTTCGTCCTTGTCAACACCATTTCTCTCAGCTACCAACCCCAAGAGAAGCGCTCGTGACTCCCATATCCCCGTGTTGGCCCCATTGCCCATTGGGTTTGCTGTTTTCATGGTTCACTTGGCCACCATTCCCATCACTGTACCAGCATTAACCCAGTAAGGAGCTTTGGTGTTGTTGTTATCTACAACAATGGCAAAGTTGGGGATGACCATTGGATATTCTGGGTTGGACCATTCGTGGGAGCGTTGGTGGCGGTGGCATACCACCAGTTTATCCTAAGAGCAGTGGCTATTAAGGCCTTAGGGTCATTCAGGAACAATCCTACCAACTAGTTACTTCATCCATAGACAGACTCTTTATTTTGTGTTTGCATTCTATGTGTGTGTATGTGTTTGATGTAGGAGAACCATGATGATGACCGGCCAATCTGTGTTTTCTTTCATTTGTAATTTACTATTTATTTATTTATTTCTTAATTTGCTTTTGTTTGTATCAGAGATCAATCTCCCCTACTAATCGTAGAGGTAATTAAGCAGG

Coding sequences of Glyma14g24424

Limit To All Plant Sequences

>Glyma14g24424.1   sequence type=CDS   gene model=Glyma14g24424   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCTTTGTCCTCGTCTACTACACCGTCGGCATTTCTGGTGGACACATTAACACTGCCGTGACTTTTGGCCTGTTCCTGGCATGCAAGGTGTCTCTCATTCGTGCCATGTTCTACATGGTAGCACATTGTTTGGGTGCTATCTGCGGTTTTGGGTTGGTGAAGGCCTTCATGAAGCACTCCTACAACTCCCTCGGCGGTGGTGCTAACTCCGTTAGCGCTGCCTACAACAAAGGCAGTGCTCTGGGTGCGGAGATCATCGACACTTTCGTCCTTGTGTTGGCCCCATTGCCCATTGGGTTTGCTGTTTTCATGGTTCACTTGGCCACCATTCCCATCACTTGGATATTCTGGGTTGGACCATTCGTGGGAGCGTTGGTGGCGGTGGCATACCACCAGTTTATCCTAAGAGCAGTGGCTATTAAGGCCTTAGGGTCATTCAGGAACAATCCTACCAACTAG

>Glyma14g24424.2   sequence type=CDS   gene model=Glyma14g24424   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCTTTGTCCTCGTCTACTACACCGTCGGCATTTCTGGTGGACACATTAACACTGCCGTGACTTTTGGCCTGTTCCTGGCATGCAAGGTGTCTCTCATTCGTGCCATGTTCTACATGGTAGCACATTGTTTGGGTGCTATCTGCGGTTTTGGGTTGGTGAAGGCCTTCATGAAGCACTCCTACAACTCCCTCGGCGGTGGTGCTAACTCCGTTAGCGCTGCCTACAACAAAGGCAGTGCTCTGGGTGCGGAGATCATCGACACTTTCGTCCTTGTCAACACCATTTCTCTCAGCTACCAACCCCAAGAGAAGCGCTCGTGA

Predicted protein sequences of Glyma14g24424

Limit To All Plant Sequences

>Glyma14g24424.1   sequence type=predicted peptide   gene model=Glyma14g24424   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIFVLVYYTVGISGGHINTAVTFGLFLACKVSLIRAMFYMVAHCLGAICGFGLVKAFMKHSYNSLGGGANSVSAAYNKGSALGAEIIDTFVLVLAPLPIGFAVFMVHLATIPITWIFWVGPFVGALVAVAYHQFILRAVAIKALGSFRNNPTN*

>Glyma14g24424.2   sequence type=predicted peptide   gene model=Glyma14g24424   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIFVLVYYTVGISGGHINTAVTFGLFLACKVSLIRAMFYMVAHCLGAICGFGLVKAFMKHSYNSLGGGANSVSAAYNKGSALGAEIIDTFVLVNTISLSYQPQEKRS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain