Glyma14g24406 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g24406): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g24406): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g24406

Feature Type:	gene_model
Chromosome:	Gm14
Start:	29313521
stop:	29314742
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g24406

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G62120	AT	Annotation by Michelle Graham. TAIR10: Class II aaRS and biotin synthetases superfamily protein \| chr3:23001227-23003849 REVERSE LENGTH=530	SoyBase	E_val: 8.00E-52	ISS
GO:0006418	GO-bp	Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation for protein translation	SoyBase	N/A	ISS
GO:0006433	GO-bp	Annotation by Michelle Graham. GO Biological Process: prolyl-tRNA aminoacylation	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0004812	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aminoacyl-tRNA ligase activity	SoyBase	N/A	ISS
GO:0004827	GO-mf	Annotation by Michelle Graham. GO Molecular Function: proline-tRNA ligase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
PTHR11451	Panther	TRNA SYNTHETASE-RELATED	JGI		ISS
PTHR11451:SF6	Panther	PROLYL-TRNA SYNTHETASE	JGI		ISS
UniRef100_G7KUM3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Bifunctional aminoacyl-tRNA synthetase n=1 Tax=Medicago truncatula RepID=G7KUM3_MEDTR	SoyBase	E_val: 2.00E-50	ISS
UniRef100_I1NBI3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NBI3_SOYBN	SoyBase	E_val: 1.00E-54	ISS

Expression Patterns of Glyma14g24406

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g24406 not represented in the dataset	Glyma14g24406 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g24406 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g153800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g24406

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g24406

Limit To All Plant Sequences

>Glyma14g24406.1   sequence type=CDS   gene model=Glyma14g24406   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGAGTACTATGATATTTCCGGTTGCTATATTCTGAGGCCTTGGTCAATGGCAATATGGGAGATCATGCAATTTTTCGATCCAGAAATAAAGAAAATGAAAATCAAGACCTGCTACTTCCCATTGTTTGTATCTCCTGAAATTCTACAAAAGGAGAAGGACCACGTTGAGGATTTTGCTCCTGAGGTGAGAGTTTGTGAATCTGTTGGCCCATGTAATGTTGACTGTTCAATAAGTTATTTTGATTTCAGGAGTCGTCAGTTTCTTTGGCAAGAAGGGCACACTGCTTTTGCAACAAAGGATGAAGCAGATGCAGAGGTTTTTGAGATTCTGGAATTATATAGGTGTATATACGAAGAGTATTTGGCGGTGTTGAGGTATATGTCTGATATTCTTGCATAA

Predicted protein sequences of Glyma14g24406

Limit To All Plant Sequences

>Glyma14g24406.1   sequence type=predicted peptide   gene model=Glyma14g24406   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVEYYDISGCYILRPWSMAIWEIMQFFDPEIKKMKIKTCYFPLFVSPEILQKEKDHVEDFAPEVRVCESVGPCNVDCSISYFDFRSRQFLWQEGHTAFATKDEADAEVFEILELYRCIYEEYLAVLRYMSDILA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain