|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G51940 | AT | Annotation by Michelle Graham. TAIR10: protein kinase family protein / peptidoglycan-binding LysM domain-containing protein | chr1:19296092-19298941 REVERSE LENGTH=651 | SoyBase | E_val: 7.00E-36 | ISS |
GO:0006468 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein phosphorylation | SoyBase | N/A | ISS |
GO:0007020 | GO-bp | Annotation by Michelle Graham. GO Biological Process: microtubule nucleation | SoyBase | N/A | ISS |
GO:0016998 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule catabolic process | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0004672 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein kinase activity | SoyBase | N/A | ISS |
GO:0004674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity | SoyBase | N/A | ISS |
GO:0004713 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity | SoyBase | N/A | ISS |
GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
GO:0016301 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: kinase activity | SoyBase | N/A | ISS |
GO:0016772 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups | SoyBase | N/A | ISS |
PTHR24420 | Panther | FAMILY NOT NAMED | JGI | ISS | |
PTHR24420:SF930 | Panther | JGI | ISS | ||
PF00069 | PFAM | Protein kinase domain | JGI | ISS | |
UniRef100_D3KTZ5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: LysM type receptor kinase n=2 Tax=Lotus japonicus RepID=D3KTZ5_LOTJA | SoyBase | E_val: 1.00E-35 | ISS |
UniRef100_I1KV17 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KV17_SOYBN | SoyBase | E_val: 4.00E-37 | ISS |
Glyma14g24351 not represented in the dataset |
Glyma14g24351 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.14g153400 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g24351.1 sequence type=CDS gene model=Glyma14g24351 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGACCCAATCCGCCGATTGGTTTCCTTCTTGGAAACACCACCACCTCCCATATGCCCAACACAACCAGATTGCAATTGATGCTGCTAGGGGCCTTCAATACATACATGAGCACACAAAAACTCATTATGTTCACCCTGATATGAAGACAAGTTACATTTTACTTGATGCTTCCTTTAGAGCAAAAATTTCAGATTTTGGGTTAGCGAAAGTTGTTGGGAAAGCAAATAAGGGAGAAATTTTAACTACCAAAGTTGTTGGTACATATGGGTATCTTGCTCCGGAGAAAAAAGGCCATCATCCGATCAGAAGGCACAATGTCAAAAAATGTTGA
>Glyma14g24351.1 sequence type=predicted peptide gene model=Glyma14g24351 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MTQSADWFPSWKHHHLPYAQHNQIAIDAARGLQYIHEHTKTHYVHPDMKTSYILLDASFRAKISDFGLAKVVGKANKGEILTTKVVGTYGYLAPEKKGHHPIRRHNVKKC*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||