SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g24240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g24240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g24240

Feature Type:gene_model
Chromosome:Gm14
Start:29001796
stop:29002455
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g24240
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G63690AT Annotation by Michelle Graham. TAIR10: SIGNAL PEPTIDE PEPTIDASE-LIKE 2 | chr1:23618490-23622082 FORWARD LENGTH=540 SoyBaseE_val: 2.00E-13ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004190GO-mf Annotation by Michelle Graham. GO Molecular Function: aspartic-type endopeptidase activity SoyBaseN/AISS
GO:0008233GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase activity SoyBaseN/AISS
PTHR12174Panther SIGNAL PEPTIDE PEPTIDASE JGI ISS
PTHR12174:SF30Panther SUBFAMILY NOT NAMED JGI ISS
PF04258PFAM Signal peptide peptidase JGI ISS
UniRef100_Q5Z413UniRef Annotation by Michelle Graham. Most informative UniRef hit: Signal peptide peptidase-like 5 n=2 Tax=Oryza sativa RepID=SIPL5_ORYSJ SoyBaseE_val: 1.00E-11ISS
UniRef100_UPI00023381D5UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023381D5 related cluster n=1 Tax=unknown RepID=UPI00023381D5 SoyBaseE_val: 2.00E-12ISS

Expression Patterns of Glyma14g24240
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g24240 not represented in the dataset
Glyma14g24240 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g24240 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g24240
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g24240
>Glyma14g24240.1   sequence type=CDS   gene model=Glyma14g24240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATCTAATACTCTTCCTCTGGTTGTAATTAAAATGCAGGAAAAATGTGTTTTTGGTCCCTGTACTTTCAGTCAAACTTGGTTTTGTTCCATTTACTTTAAAATTGATGAATTTAGTCCTTCAATTGTTGAAAATATGTTAATTGGAACTGTTCTTCTCAGTTGTGCCTTCCTATATGACATCTTCTGGGTGTTTGTCTCTAAACGATGGTTCCATGAGAGTGTGATGATAGTGGGGAGTGTTTTAAAGAACAATCCCATGCCTCTACTATAA
Predicted protein sequences of Glyma14g24240
>Glyma14g24240.1   sequence type=predicted peptide   gene model=Glyma14g24240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESNTLPLVVIKMQEKCVFGPCTFSQTWFCSIYFKIDEFSPSIVENMLIGTVLLSCAFLYDIFWVFVSKRWFHESVMIVGSVLKNNPMPLL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo