SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma14g24220

Feature Type:gene_model
Chromosome:Gm14
Start:28985135
stop:28987338
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G01720AT Annotation by Michelle Graham. TAIR10: NAC (No Apical Meristem) domain transcriptional regulator superfamily protein | chr1:268471-269514 FORWARD LENGTH=289 SoyBaseE_val: 6.00E-147ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007275GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organismal development SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009788GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF02365PFAM No apical meristem (NAM) protein JGI ISS
UniRef100_B2ZGR3UniRef Annotation by Michelle Graham. Best UniRef hit: NAC domain protein n=1 Tax=Glycine max RepID=B2ZGR3_SOYBN SoyBaseE_val: 0ISS
UniRef100_B2ZGR3UniRef Annotation by Michelle Graham. Most informative UniRef hit: NAC domain protein n=1 Tax=Glycine max RepID=B2ZGR3_SOYBN SoyBaseE_val: 0ISS

LocusGene SymbolProtein Name
NAC109 NAC Transcription Factor gene 109

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma02g26480 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g152700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g24220.1   sequence type=CDS   gene model=Glyma14g24220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACTACAACACAACTTCACTTACCCCCTGGATTCAGATTCCATCCAACAGATGAAGAACTCGTCATCCACTACCTTTGTCGCAAATGCGCTTCGCAACATATCGCGGTTCCCATAATCGCCGAAATTGATCTGTACAAGTACGACCCTTGGGACCTTCCAGGAATGGCTTTGTACGGAGAGAAAGAGTGGTATTTTTTCACGCCGAGGGACCGCAAGTACCCGAACGGTTCGCGGCCGAACCGGTCCGCGGGAACCGGGTACTGGAAGGCAACCGGAGCGGATAAACCAGTTGGTAAACCGAAACCGGTTGGGATCAAGAAAGCGTTGGTTTTTTACGCTGGAAAAGCGCCCAAGGGAGAGAAAACTAACTGGATCATGCACGAGTATCGTCTTGCAGACGTGGATCGTTCCGTTCGCAAAAAGAACAGCTTAAGGCTGGATGACTGGGTGCTGTGCCGAATTTACAACAAGAAAGGTGCAATTGAAAAGCAACAACTACCACCACCGAGTGGGGTCCGCAAAATTGAATGTTCCGAAATGGAGGACGAGAAGCCGGAGATTCTGCCGCCAGATCCGCCGTATACGGCGGCGACGGTGGCGGATTGCCTGTACTTCGAGGCTTCCGACTCGGTGCCCCGGCTGCACACGACGGACTCGAGCTGCTCCGAGCAGGTGGTGTCGGCGGAGTTTGCGAGCGAGGTGCAGAGCGAGCCGAAGAGGGGCAGCAACAACAACAACGAGTTTGCATATAATTACGTGGATGCCACTCTCGGGAATAATCAGATGTCGCCGCTGCAGGATATTTTCATGTACCTCTCCAAGTCCTTCTGCAATTAA

>Glyma14g24220.1   sequence type=predicted peptide   gene model=Glyma14g24220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATTTQLHLPPGFRFHPTDEELVIHYLCRKCASQHIAVPIIAEIDLYKYDPWDLPGMALYGEKEWYFFTPRDRKYPNGSRPNRSAGTGYWKATGADKPVGKPKPVGIKKALVFYAGKAPKGEKTNWIMHEYRLADVDRSVRKKNSLRLDDWVLCRIYNKKGAIEKQQLPPPSGVRKIECSEMEDEKPEILPPDPPYTAATVADCLYFEASDSVPRLHTTDSSCSEQVVSAEFASEVQSEPKRGSNNNNEFAYNYVDATLGNNQMSPLQDIFMYLSKSFCN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo