Glyma14g23960 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g23960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g23960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g23960

Feature Type:	gene_model
Chromosome:	Gm14
Start:	28523473
stop:	28528404
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g23960

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G21780	AT	Annotation by Michelle Graham. TAIR10: BTB/POZ domain-containing protein \| chr1:7652476-7653866 FORWARD LENGTH=326	SoyBase	E_val: 3.00E-176	ISS
GO:0006635	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation	SoyBase	N/A	ISS
GO:0006891	GO-bp	Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009954	GO-bp	Annotation by Michelle Graham. GO Biological Process: proximal/distal pattern formation	SoyBase	N/A	ISS
GO:0010227	GO-bp	Annotation by Michelle Graham. GO Biological Process: floral organ abscission	SoyBase	N/A	ISS
GO:0016558	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix	SoyBase	N/A	ISS
GO:0048439	GO-bp	Annotation by Michelle Graham. GO Biological Process: flower morphogenesis	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0031463	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Cul3-RING ubiquitin ligase complex	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR24413	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24413:SF216	Panther		JGI		ISS
PF00651	PFAM	BTB/POZ domain	JGI		ISS
UniRef100_D7KKU4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: BTB/POZ domain-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KKU4_ARALL	SoyBase	E_val: 5.00E-172	ISS
UniRef100_I1MA51	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MA51_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma14g23960

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g23960 not represented in the dataset	Glyma14g23960 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g23960

Paralog	Evidence	Comments
Glyma13g03460	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g23960 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g151300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g23960

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g23960

Limit To All Plant Sequences

>Glyma14g23960.1   sequence type=CDS   gene model=Glyma14g23960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCGATTCGAAGGTCGAAACCATCGCCAGATTAGCCCAATGGAAAATCGACAACTTCGGACCCTGCTCCTACAAGAAATCAGACCCTTTCAAGCTCGGAATTTGGAACTGGTTCATGTCCATAGAGAGGAACAGGTACCTCTACATACACATCTTTCCGGAGCCTTCTCGGCTTACTAAGGAACAGCCACCCGTGGCACGCTTCATCCTGCGAGTCTCCAACAACTCTGGCCCTACCCGCAAATTTTACATTTCCCCTGTTCATGAAAGGGTGCTTAGGACATGTGAAGACTTTGTCTGGCCTGTTGATACTGCATTCCTTGGTCGCTTCGTTATTGATATTGAATTTCTTGACCTGAGGACCTGCCCCGTGAATGGTGAAACCAGATCTGTATGGCCATCTGATGGAAAACTGCAAACTGTTGCAGCTCAAAGCACTCTTCGATGCTTGTCCCGTATGCTTGATGAGGCTATACATGCTGACCTCACCATTATCACTGCAGATGGTACCCTGAGGGCTCATAAGGCAGTTTTATCTGCAAGTTCTACTGTGTTCCATAGCTTGTATCTTCACAATGGTGATGAGAAAGAGACATCTACAATCCACATAGAAGATATGTCTCAAGAATCCTGCATGGCCCTTCTGAGTTACTTGTACGGCACTATAAAGCAACAAGATTTCTGGAAGCACAGGCTTGCATTGCTTGGAGCAGCCAATAAATATGAGATTGGTGATCTCAAAGATGCCAGTGAGGAAAGCCTACTGGAAGATCTTAACTCGGGAAATGTTCTGGATAGGCTAAATGATGCGAGGCTTTACCAGTTGCACAAGTTAAAGAAAGGATGTTTCTCATACTTATTTGATTTTGGTAAGATATATGATGTTAGAGATGAAATAGATACCTTTTTCCGACATGCAGATAGGGAGCTAATGCTGGAGATGTTTCAGGAAGTGCTTACAATTTCAAAATAG

Predicted protein sequences of Glyma14g23960

Limit To All Plant Sequences

>Glyma14g23960.1   sequence type=predicted peptide   gene model=Glyma14g23960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSDSKVETIARLAQWKIDNFGPCSYKKSDPFKLGIWNWFMSIERNRYLYIHIFPEPSRLTKEQPPVARFILRVSNNSGPTRKFYISPVHERVLRTCEDFVWPVDTAFLGRFVIDIEFLDLRTCPVNGETRSVWPSDGKLQTVAAQSTLRCLSRMLDEAIHADLTIITADGTLRAHKAVLSASSTVFHSLYLHNGDEKETSTIHIEDMSQESCMALLSYLYGTIKQQDFWKHRLALLGAANKYEIGDLKDASEESLLEDLNSGNVLDRLNDARLYQLHKLKKGCFSYLFDFGKIYDVRDEIDTFFRHADRELMLEMFQEVLTISK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain