SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g23621

Feature Type:gene_model
Chromosome:Gm14
Start:28042823
stop:28044009
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g23621
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G48140AT Annotation by Michelle Graham. TAIR10: Pectin lyase-like superfamily protein | chr5:19518907-19520412 REVERSE LENGTH=395 SoyBaseE_val: 2.00E-34ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0004650GO-mf Annotation by Michelle Graham. GO Molecular Function: polygalacturonase activity SoyBaseN/AISS
PF00295PFAM Glycosyl hydrolases family 28 JGI ISS
UniRef100_A2Q437UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pectolytic enzyme, Pectin lyase fold n=1 Tax=Medicago truncatula RepID=A2Q437_MEDTR SoyBaseE_val: 3.00E-63ISS
UniRef100_I1MB90UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1MB90_SOYBN SoyBaseE_val: 2.00E-80ISS

Expression Patterns of Glyma14g23621
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g23621 not represented in the dataset
Glyma14g23621 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g23621 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g149200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g23621
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g23621
>Glyma14g23621.1   sequence type=CDS   gene model=Glyma14g23621   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAATGGTTTTTCCTCATAGTATGGTCACAATAGCTTTGGTGCTAATGTTAGCTTCATATGTCAAAGCTCATGTTGGCCTTTTTGATATAAGAAAATATGGTGCAATACCTAATGGAGATACGACCATGGATTTGCAGAATGCTTGGAGGGATGCATGTGTATCAATGACTCCAAGCAAAGTTGTAGTTCCTAGTGGTAAATATAAGTTGAGACAAATAGACTTTATGGGACTTATAAAGCTCATATTAAGGATTAGATTTGGATATATTAATTTCTTAACCTTATTTGGTAATGGAACTTTTCACGGTCAAGGCAAAATGGCTTGGAAACAAAATAATTGTGCAAAAAACAAGAATTGCAAAAAGCTCGCCATGAAAATTAACTCAAGCGATGGGAGTAAAGAAGTCACTATCCTAAATGTAACATGCGAACCTAGACATGGTATTAGTGTTGGAAGCTTAGGAAAATATTCAAATGAAGAGTCTGTAGAAGATCTTACTATCAAGAATTGTACACTAAAAAACACAAACAATGGTCTAAGGATCAAAACTTGGCCTAGTACTCCAATAACTTCTCTTGTGCCTAATTTGCATTTTGAAGATATCATAATGATTAATGTCAACAACCCTATAATTATAGGTCAAGAGTATTGTCCATGGAATCAATGCTCAATATAG
Predicted protein sequences of Glyma14g23621
>Glyma14g23621.1   sequence type=predicted peptide   gene model=Glyma14g23621   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKMVFPHSMVTIALVLMLASYVKAHVGLFDIRKYGAIPNGDTTMDLQNAWRDACVSMTPSKVVVPSGKYKLRQIDFMGLIKLILRIRFGYINFLTLFGNGTFHGQGKMAWKQNNCAKNKNCKKLAMKINSSDGSKEVTILNVTCEPRHGISVGSLGKYSNEESVEDLTIKNCTLKNTNNGLRIKTWPSTPITSLVPNLHFEDIIMINVNNPIIIGQEYCPWNQCSI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo