SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g23290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g23290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g23290

Feature Type:gene_model
Chromosome:Gm14
Start:27722103
stop:27723784
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g23290
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G61540AT Annotation by Michelle Graham. TAIR10: N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein | chr5:24744994-24747142 FORWARD LENGTH=359 SoyBaseE_val: 6.00E-52ISS
GO:0006516GO-bp Annotation by Michelle Graham. GO Biological Process: glycoprotein catabolic process SoyBaseN/AISS
GO:0033345GO-bp Annotation by Michelle Graham. GO Biological Process: asparagine catabolic process via L-aspartate SoyBaseN/AISS
GO:0051604GO-bp Annotation by Michelle Graham. GO Biological Process: protein maturation SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003948GO-mf Annotation by Michelle Graham. GO Molecular Function: N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity SoyBaseN/AISS
GO:0004067GO-mf Annotation by Michelle Graham. GO Molecular Function: asparaginase activity SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
PTHR10188Panther PROTEASE T2 ASPARAGINASE JGI ISS
PTHR10188:SF6Panther N(4)-(BETA-N-ACETYLGLUCOSAMINYL)-L-ASPARAGINASE JGI ISS
PF01112PFAM Asparaginase JGI ISS
UniRef100_B9R9W8UniRef Annotation by Michelle Graham. Most informative UniRef hit: N(4)-(Beta-n-acetylglucosaminyl)-l-asparaginase, putative n=1 Tax=Ricinus communis RepID=B9R9W8_RICCO SoyBaseE_val: 2.00E-50ISS
UniRef100_I1KFQ5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KFQ5_SOYBN SoyBaseE_val: 6.00E-65ISS

Expression Patterns of Glyma14g23290
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g23290 not represented in the dataset
Glyma14g23290 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g23290 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g23290
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g23290
>Glyma14g23290.1   sequence type=CDS   gene model=Glyma14g23290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCACCTCTAGATGAGAATGGAGAAACTATAATTGATGCTCTGATAATGGATGGGATGACAATGGAAGTAGGAGCTGTTGCAGCCATGAGATATGTAAAGGATGGAATTAAAGTTGCCAGGTTAGTGATGCAACATACTAAACACACTTTGCTGGTAGGAGAGAAAGCATCAGAATTTGCTATTTCAATGCGTCTTCCAGGTCCCATGAACTTGAGTTCACCAGAATCTATGGAGAAGTGGGCCAAATGGAAAGATAGTCGTTGTCAACCAAATTTCAAGAAAAATATGCTAACTAGTAATTCCAATTTACTTCTTGTTAGTCTTCATAGCCATGATACTATATCAATGGCTGTTATTGGTAGAGTAAGATATAACAAAAAATTGATT
Predicted protein sequences of Glyma14g23290
>Glyma14g23290.1   sequence type=predicted peptide   gene model=Glyma14g23290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSPLDENGETIIDALIMDGMTMEVGAVAAMRYVKDGIKVARLVMQHTKHTLLVGEKASEFAISMRLPGPMNLSSPESMEKWAKWKDSRCQPNFKKNMLTSNSNLLLVSLHSHDTISMAVIGRVRYNKKLI






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo