|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G66680 | AT | Annotation by Michelle Graham. TAIR10: dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48kDa subunit family protein | chr5:26617840-26620581 REVERSE LENGTH=437 | SoyBase | E_val: 1.00E-19 | ISS |
| GO:0001510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA methylation | SoyBase | N/A | ISS |
| GO:0009664 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization | SoyBase | N/A | ISS |
| GO:0009826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth | SoyBase | N/A | ISS |
| GO:0018279 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation via asparagine | SoyBase | N/A | ISS |
| GO:0030244 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process | SoyBase | N/A | ISS |
| GO:0042545 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall modification | SoyBase | N/A | ISS |
| GO:0048193 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005730 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleolus | SoyBase | N/A | ISS |
| GO:0005773 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuole | SoyBase | N/A | ISS |
| GO:0005774 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane | SoyBase | N/A | ISS |
| GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
| GO:0005789 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum membrane | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0008250 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: oligosaccharyltransferase complex | SoyBase | N/A | ISS |
| GO:0009505 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0004579 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: dolichyl-diphosphooligosaccharide-protein glycotransferase activity | SoyBase | N/A | ISS |
| UniRef100_B9RZC1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase, putative n=1 Tax=Ricinus communis RepID=B9RZC1_RICCO | SoyBase | E_val: 3.00E-21 | ISS |
| UniRef100_I1LQ58 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LQ58_SOYBN | SoyBase | E_val: 7.00E-28 | ISS |
|
Glyma14g22220 not represented in the dataset |
Glyma14g22220 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.14g145500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g22220.1 sequence type=CDS gene model=Glyma14g22220 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high AGGAAAATGTTGACATTGGTTCTAAGAGTTCATTTTACACATATAAAGTTGACAATTGACATTTGCTATGTGTCTATACTATGGTGCTGTAATTTGATTACTTGTTATTTGGATGTTACTATTTGGCACTTTCAAGATCCTGCTGCTGTGGTTGTGGATCATTCAGGATATGCAGTGTCTGCTACTGAAGGAGATCATACATTGATTGCTAGTGATGATTTTATCAATATTAATTTGTTATTTTCTCGTTACATGCAACAGGCTCCAGTGTTGAAAGTTCTCTCTGCATCTCCTACAACCTTTTCTGCTAATCCAAAATCTAAAGTGACAACTCCTCCATCACTCACTGGAACTTCAATTATACAGGCATGA
>Glyma14g22220.1 sequence type=predicted peptide gene model=Glyma14g22220 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high RKMLTLVLRVHFTHIKLTIDICYVSILWCCNLITCYLDVTIWHFQDPAAVVVDHSGYAVSATEGDHTLIASDDFININLLFSRYMQQAPVLKVLSASPTTFSANPKSKVTTPPSLTGTSIIQA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||