SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g22220): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g22220): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g22220

Feature Type:gene_model
Chromosome:Gm14
Start:26361567
stop:26362542
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G66680AT Annotation by Michelle Graham. TAIR10: dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48kDa subunit family protein | chr5:26617840-26620581 REVERSE LENGTH=437 SoyBaseE_val: 1.00E-19ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0018279GO-bp Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation via asparagine SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0042545GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall modification SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005789GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0008250GO-cc Annotation by Michelle Graham. GO Cellular Compartment: oligosaccharyltransferase complex SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0004579GO-mf Annotation by Michelle Graham. GO Molecular Function: dolichyl-diphosphooligosaccharide-protein glycotransferase activity SoyBaseN/AISS
UniRef100_B9RZC1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase, putative n=1 Tax=Ricinus communis RepID=B9RZC1_RICCO SoyBaseE_val: 3.00E-21ISS
UniRef100_I1LQ58UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LQ58_SOYBN SoyBaseE_val: 7.00E-28ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g22220 not represented in the dataset

Glyma14g22220 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g145500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g22220.1   sequence type=CDS   gene model=Glyma14g22220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGGAAAATGTTGACATTGGTTCTAAGAGTTCATTTTACACATATAAAGTTGACAATTGACATTTGCTATGTGTCTATACTATGGTGCTGTAATTTGATTACTTGTTATTTGGATGTTACTATTTGGCACTTTCAAGATCCTGCTGCTGTGGTTGTGGATCATTCAGGATATGCAGTGTCTGCTACTGAAGGAGATCATACATTGATTGCTAGTGATGATTTTATCAATATTAATTTGTTATTTTCTCGTTACATGCAACAGGCTCCAGTGTTGAAAGTTCTCTCTGCATCTCCTACAACCTTTTCTGCTAATCCAAAATCTAAAGTGACAACTCCTCCATCACTCACTGGAACTTCAATTATACAGGCATGA

>Glyma14g22220.1   sequence type=predicted peptide   gene model=Glyma14g22220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
RKMLTLVLRVHFTHIKLTIDICYVSILWCCNLITCYLDVTIWHFQDPAAVVVDHSGYAVSATEGDHTLIASDDFININLLFSRYMQQAPVLKVLSASPTTFSANPKSKVTTPPSLTGTSIIQA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo