SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g21430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g21430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g21430

Feature Type:gene_model
Chromosome:Gm14
Start:24944285
stop:24947952
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g21430
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G20010AT Annotation by Michelle Graham. TAIR10: plastid transcriptionally active 9 | chr4:10842128-10843989 FORWARD LENGTH=371 SoyBaseE_val: 6.00E-32ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009295GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleoid SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009508GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid chromosome SoyBaseN/AISS
GO:0003697GO-mf Annotation by Michelle Graham. GO Molecular Function: single-stranded DNA binding SoyBaseN/AISS
UniRef100_C6T7T9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T7T9_SOYBN SoyBaseE_val: 8.00E-53ISS
UniRef100_Q8GXH3-2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Isoform 2 of Protein OSB2, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=Q8GXH3-2 SoyBaseE_val: 3.00E-29ISS

Expression Patterns of Glyma14g21430
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g21430 not represented in the dataset
Glyma14g21430 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g21430 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g21430
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g21430
>Glyma14g21430.1   sequence type=CDS   gene model=Glyma14g21430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGTCATGGCAAGGCTTCTCGCTGCTGAGACTTTCTCTCACACTGTAGCAGGTAGGTACATGGAGACCCTACCTTTTAGAATTTCTTACTCATACTGCCTGACATTGTTTGCTGGATTTAGAATAAACCAGTGCAATGGATTGCACCCTGATTTCAAACGCAAGGATGGCTATTCTTTCTGGCTTGGCAAGGATGAAAAGTGGGTTTTGCCTAAATTGGAAGGACTTCAATTTGATAATCAAGAGTTAAGCAAGTTCCAAAGAATCAGGAGTCAAAAAGCTTCAAGAATCAAGATTCAAGACTCAAGAGAAGACTCAATCAAGATAAGCCACTTGATCCAACATGATTTGGTGCAAAACTATGCTAACTGGTGGGATAATAGATTAAATAAGAGGAATGCAAAAGCTCCCGATTTCAAGCACAAAGAAACCAGTAAAGGGTTGTGGCTTGATTCTTCATCAAAGTGGGTGTTGGAAAAATTGCCGCCACCTATGAAGCCTAAACAAAGTGTAGATACTGAAAGGACACTGGTTTCATAA
Predicted protein sequences of Glyma14g21430
>Glyma14g21430.1   sequence type=predicted peptide   gene model=Glyma14g21430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVMARLLAAETFSHTVAGRYMETLPFRISYSYCLTLFAGFRINQCNGLHPDFKRKDGYSFWLGKDEKWVLPKLEGLQFDNQELSKFQRIRSQKASRIKIQDSREDSIKISHLIQHDLVQNYANWWDNRLNKRNAKAPDFKHKETSKGLWLDSSSKWVLEKLPPPMKPKQSVDTERTLVS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo