SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g21130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g21130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g21130

Feature Type:gene_model
Chromosome:Gm14
Start:24402928
stop:24406593
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g21130
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G24570AT Annotation by Michelle Graham. TAIR10: Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein | chr3:8966675-8968530 REVERSE LENGTH=235 SoyBaseE_val: 2.00E-106ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005778GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisomal membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG1944 KOG Peroxisomal membrane protein MPV17 and related proteins JGI ISS
PTHR11266Panther PEROXISOMAL MEMBRANE PROTEIN 2, PXMP2 JGI ISS
PF04117PFAM Mpv17 / PMP22 family JGI ISS
UniRef100_G7I4C4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein Mpv17 n=1 Tax=Medicago truncatula RepID=G7I4C4_MEDTR SoyBaseE_val: 3.00E-131ISS
UniRef100_UPI000043DE7AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000043DE7A related cluster n=1 Tax=unknown RepID=UPI000043DE7A SoyBaseE_val: 7.00E-152ISS

Expression Patterns of Glyma14g21130
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g21130 not represented in the dataset
Glyma14g21130 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g21130 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g141500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g21130
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g21130
>Glyma14g21130.1   sequence type=CDS   gene model=Glyma14g21130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGAGGTTGTGGAAATGGTACCAGAATTGCTTGGCGGTTCACCCTGTTAAGACACAGGTCATCAGCTCTGGCTTGATTTGGGGTGCTGGTGACATAGCTGCTCAGGCAGTTACCCACTACACTGCCAAGAAACGTGTCACTTTTGATGCGGATGACACTAAAGAATTCAAGATCAACTGGAGACGGGTGTCTACGACCAGCTTGTTTGGGTTAGGATTTGTTGGCCCTGTTGGCCACTTCTGGTACGAAGGTTTGGATCGGTTTATAAGACTGAAACTCATGCTTAAACCGAATTCCTTCCGCTTTGTTGCCACTAAAGTTGCCGTTGATGGGTTTATCTTTGGACCATTGGATTTACTTGTGTTTTTCACTTATATGGGTTTTTCTGCTGGAAAGAGTGTTCCTCAAGTAAAAGAAGATGTGAAGAGAGATTTTCTCCCAGCCTTTGTTTTAGAAGGGGGCATATGGCCAATTGTTCAGGTTGCGAACTTTCGGTTTATACCTGTGAGGTATCAACTCCTTTATGTCAACTTCTTCTGCTTGTTGGATAGCTGTTTCTTGTCTTGGGTTGAGCAACAACAGGATGCTCCATGGAAACAATGGTTGAAATCATTTCTACCTATGAAGTAA
Predicted protein sequences of Glyma14g21130
>Glyma14g21130.1   sequence type=predicted peptide   gene model=Glyma14g21130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLRLWKWYQNCLAVHPVKTQVISSGLIWGAGDIAAQAVTHYTAKKRVTFDADDTKEFKINWRRVSTTSLFGLGFVGPVGHFWYEGLDRFIRLKLMLKPNSFRFVATKVAVDGFIFGPLDLLVFFTYMGFSAGKSVPQVKEDVKRDFLPAFVLEGGIWPIVQVANFRFIPVRYQLLYVNFFCLLDSCFLSWVEQQQDAPWKQWLKSFLPMK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo