SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g20400

Feature Type:gene_model
Chromosome:Gm14
Start:23463826
stop:23464802
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g20400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G11470AT Annotation by Michelle Graham. TAIR10: bromo-adjacent homology (BAH) domain-containing protein | chr5:3662757-3667041 REVERSE LENGTH=757 SoyBaseE_val: 2.00E-38ISS
GO:0006333GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
PF01426PFAM BAH domain JGI ISS
UniRef100_F4JXV7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Bromo-adjacent homology (BAH) domain-containing protein n=1 Tax=Arabidopsis thaliana RepID=F4JXV7_ARATH SoyBaseE_val: 9.00E-36ISS
UniRef100_I1M9X3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M9X3_SOYBN SoyBaseE_val: 2.00E-129ISS

Expression Patterns of Glyma14g20400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g20400 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g140600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g20400
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g20400
>Glyma14g20400.1   sequence type=CDS   gene model=Glyma14g20400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGAACCAATGGCTGTCGACTCCAATCCCGAATCCGGTCTCGACTTCGAGTCCCCTTTCGCCTGGGGGAAGAAGCGAGGCATGGGAGGCAAAAAGAAGGACGTGCAGTTCTACGAGTCATTCTCCTTCGACGGTGCCGAGTACGCCATAAACGACACCGTATGCCTCCAGAGCGGGATCGGCGGTGGCGAGCCCCACATCGGGAGGCTGATCAAGATCTGGGAGACCCGCGACAAGTCCAGGAAGGTGAAGGTGCAGTGGTTCTTCCGCCCCGCCGAGATCTGCAAGTACTTGGTTGGGATCGAAGTGAAGCCGAACGAGTTGTTCCTCGCGTGCGGCGGCGACGGCGCCAAGGGCTTTGCCAATGTCAATCCTTTGGAAGCTATTGTAGGGAAATGCAATGTTGTTTGCATTTCTAAGGACGTTGGGAATCCGCAACCGTCAGGTGAAGCAAAGGCTGATTATGTGTACTATCGTTTCTTTGATGTTGTGCAATTGAAAGTAGTGGATCAGATAGATGTCAAGGTTGCTGCGGGAATTGAA
Predicted protein sequences of Glyma14g20400
>Glyma14g20400.1   sequence type=predicted peptide   gene model=Glyma14g20400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEPMAVDSNPESGLDFESPFAWGKKRGMGGKKKDVQFYESFSFDGAEYAINDTVCLQSGIGGGEPHIGRLIKIWETRDKSRKVKVQWFFRPAEICKYLVGIEVKPNELFLACGGDGAKGFANVNPLEAIVGKCNVVCISKDVGNPQPSGEAKADYVYYRFFDVVQLKVVDQIDVKVAAGIE






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo