|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G25735 | AT | Annotation by Michelle Graham. TAIR10: unknown protein; Has 31 Blast hits to 31 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 31; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:10975345-10975704 REVERSE LENGTH=119 | SoyBase | E_val: 4.00E-11 | ISS |
| GO:0002237 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to molecule of bacterial origin | SoyBase | N/A | ISS |
| GO:0002679 | GO-bp | Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response | SoyBase | N/A | ISS |
| GO:0006979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to oxidative stress | SoyBase | N/A | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0009611 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to wounding | SoyBase | N/A | ISS |
| GO:0010200 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to chitin | SoyBase | N/A | ISS |
| GO:0030968 | GO-bp | Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response | SoyBase | N/A | ISS |
| GO:0035556 | GO-bp | Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction | SoyBase | N/A | ISS |
| GO:0050832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| UniRef100_I1M9X2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M9X2_SOYBN | SoyBase | E_val: 1.00E-73 | ISS |
| UniRef100_Q8RUI1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis thaliana RepID=Q8RUI1_ARATH | SoyBase | E_val: 2.00E-08 | ISS |
|
Glyma14g20390 not represented in the dataset |
Glyma14g20390 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.14g140500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g20390.1 sequence type=CDS gene model=Glyma14g20390 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAGGATATCAAGAAGTATTGGTTCAATGCAAGCAGCCCAAGTACTACTCAAAGCATAAGGTTGGGTCGGAGCTACACAAAACCGCACTATGAGAGCAACCGTGATGGCACAAAACCAATGTGGCAAATGCTTTGGAGAAAGCTCAAAAGGGATCATAAGAAGAAAGGGTTTGGTTCAATGGAGGGTATTTATGACCCGGAATCATACTCTATGAACTTTGATCATGGAACTGGATGGATGGAGCCTGATAACCTCCCTCGTTCCTTCTCTTCTCGGTATGCTGACCCATCTAGGATCTTACCACCTAGACATTTATTGGATTAA
>Glyma14g20390.1 sequence type=predicted peptide gene model=Glyma14g20390 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKDIKKYWFNASSPSTTQSIRLGRSYTKPHYESNRDGTKPMWQMLWRKLKRDHKKKGFGSMEGIYDPESYSMNFDHGTGWMEPDNLPRSFSSRYADPSRILPPRHLLD*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||