SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g20380): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g20380): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g20380

Feature Type:gene_model
Chromosome:Gm14
Start:23435639
stop:23439167
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g20380
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G32690AT Annotation by Michelle Graham. TAIR10: hemoglobin 3 | chr4:15765486-15766862 FORWARD LENGTH=175 SoyBaseE_val: 3.00E-94ISS
GO:0001666GO-bp Annotation by Michelle Graham. GO Biological Process: response to hypoxia SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0015671GO-bp Annotation by Michelle Graham. GO Biological Process: oxygen transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005344GO-mf Annotation by Michelle Graham. GO Molecular Function: oxygen transporter activity SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0019825GO-mf Annotation by Michelle Graham. GO Molecular Function: oxygen binding SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PF01152PFAM Bacterial-like globin JGI ISS
UniRef100_A2TDC3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Truncated hemoglobin n=1 Tax=Populus tremula x Populus tremuloides RepID=A2TDC3_9ROSI SoyBaseE_val: 1.00E-104ISS
UniRef100_I1M9X1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M9X1_SOYBN SoyBaseE_val: 4.00E-124ISS

Expression Patterns of Glyma14g20380
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g20380 not represented in the dataset
Glyma14g20380 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g20380 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g140400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g20380
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g20380
>Glyma14g20380.1   sequence type=CDS   gene model=Glyma14g20380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGAGTCTGCAACAGAAGGCTTCCGAATGGAGCGGTGTTTCCATAGACGACGCTTTCGGCATCGACGACACCAATCTCTTCCAGAAACTCGGCCTCCAAACCTTCATTAACCTCTCCACCAATTTCTACAACAGGGTTTACGATGACGAGGAAGAATGGTTTCGTTCAATATTCGCGAATTCTGAGAAGGAGAATGCCATTCAAAACCAATACGAGTTCTTCGTGCAGCGAATGGGTGGTCCTCCTCTCTTTTCTCAGAGAAGAGGACATCCTGCTCTAATTGCTCGACATCGACCATTTCCTGTCACGCATCAAGCTGCAGAGAGGTGGTTACATCACATGCAACATGCATTAGACAGTACTACAGATATAGATGATGACTCAAAGACCAAAATGATGAACTTTTTCAGGCACACTGCATATTTTTTGGTGGCTGGAGATGAGCTAAAGAATCAAAACCAACATATTCCATGCAAACATGCAGCAGCCAAAAAGGATGATTCTTGA
Predicted protein sequences of Glyma14g20380
>Glyma14g20380.1   sequence type=predicted peptide   gene model=Glyma14g20380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQSLQQKASEWSGVSIDDAFGIDDTNLFQKLGLQTFINLSTNFYNRVYDDEEEWFRSIFANSEKENAIQNQYEFFVQRMGGPPLFSQRRGHPALIARHRPFPVTHQAAERWLHHMQHALDSTTDIDDDSKTKMMNFFRHTAYFLVAGDELKNQNQHIPCKHAAAKKDDS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo