SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g20371): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g20371): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g20371

Feature Type:gene_model
Chromosome:Gm14
Start:23337398
stop:23338031
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G47470AT Annotation by Michelle Graham. TAIR10: thioredoxin family protein | chr2:19481503-19483683 FORWARD LENGTH=361 SoyBaseE_val: 1.00E-24ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006662GO-bp Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process SoyBaseN/AISS
GO:0009553GO-bp Annotation by Michelle Graham. GO Biological Process: embryo sac development SoyBaseN/AISS
GO:0009567GO-bp Annotation by Michelle Graham. GO Biological Process: double fertilization forming a zygote and endosperm SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048868GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube development SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0003756GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide isomerase activity SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
GO:0016853GO-mf Annotation by Michelle Graham. GO Molecular Function: isomerase activity SoyBaseN/AISS
PF07749PFAM Endoplasmic reticulum protein ERp29, C-terminal domain JGI ISS
UniRef100_E3W9C2UniRef Annotation by Michelle Graham. Best UniRef hit: Protein disulfide isomerase S-1 (Fragment) n=1 Tax=Glycine max RepID=E3W9C2_SOYBN SoyBaseE_val: 1.00E-35ISS
UniRef100_E3W9C2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein disulfide isomerase S-1 (Fragment) n=1 Tax=Glycine max RepID=E3W9C2_SOYBN SoyBaseE_val: 1.00E-35ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g20371 not represented in the dataset

Glyma14g20371 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g140200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g20371.1   sequence type=CDS   gene model=Glyma14g20371   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAGGAAGTTGAGAAGCTGAAGGGTTCTGCCTCAAGGCACGGGAAGATTTACTTGAAAGCTACCAAGAATTACTTGGAAAAAGGTTCTGATTATGCTAATAACGAAATCCATCGCCTACAGCGCATACTTGACAAGTCCATTAGTCCTGCGAAGGTCGACGAGTTAACTCTAAAGAAAAATATCTTGTCGACATATGCTGCTTGA

>Glyma14g20371.1   sequence type=predicted peptide   gene model=Glyma14g20371   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEEVEKLKGSASRHGKIYLKATKNYLEKGSDYANNEIHRLQRILDKSISPAKVDELTLKKNILSTYAA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo