Report for Sequence Feature Glyma14g20360
Feature Type: gene_model
Chromosome: Gm14
Start: 23336396
stop: 23337161
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma14g20360
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G47470 AT
Annotation by Michelle Graham. TAIR10: thioredoxin family protein | chr2:19481503-19483303 FORWARD LENGTH=266
SoyBase E_val: 4.00E-42 ISS
GO:0006094 GO-bp
Annotation by Michelle Graham. GO Biological Process: gluconeogenesis
SoyBase N/A ISS
GO:0006096 GO-bp
Annotation by Michelle Graham. GO Biological Process: glycolysis
SoyBase N/A ISS
GO:0006662 GO-bp
Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process
SoyBase N/A ISS
GO:0009553 GO-bp
Annotation by Michelle Graham. GO Biological Process: embryo sac development
SoyBase N/A ISS
GO:0009567 GO-bp
Annotation by Michelle Graham. GO Biological Process: double fertilization forming a zygote and endosperm
SoyBase N/A ISS
GO:0009627 GO-bp
Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance
SoyBase N/A ISS
GO:0009651 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to salt stress
SoyBase N/A ISS
GO:0009793 GO-bp
Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy
SoyBase N/A ISS
GO:0034976 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress
SoyBase N/A ISS
GO:0045454 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis
SoyBase N/A ISS
GO:0046686 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cadmium ion
SoyBase N/A ISS
GO:0048868 GO-bp
Annotation by Michelle Graham. GO Biological Process: pollen tube development
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0005774 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane
SoyBase N/A ISS
GO:0005783 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum
SoyBase N/A ISS
GO:0009505 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall
SoyBase N/A ISS
GO:0003756 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein disulfide isomerase activity
SoyBase N/A ISS
GO:0009055 GO-mf
Annotation by Michelle Graham. GO Molecular Function: electron carrier activity
SoyBase N/A ISS
GO:0015035 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity
SoyBase N/A ISS
GO:0016853 GO-mf
Annotation by Michelle Graham. GO Molecular Function: isomerase activity
SoyBase N/A ISS
PTHR18929 Panther
PROTEIN DISULFIDE ISOMERASE
JGI ISS
PF00085 PFAM
Thioredoxin
JGI ISS
UniRef100_C6T9F8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T9F8_SOYBN
SoyBase E_val: 3.00E-50 ISS
UniRef100_E3W9C2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Protein disulfide isomerase S-1 (Fragment) n=1 Tax=Glycine max RepID=E3W9C2_SOYBN
SoyBase E_val: 5.00E-50 ISS
Expression Patterns of Glyma14g20360
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma14g20360 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma14g20360
Coding sequences of Glyma14g20360
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma14g20360.1 sequence type=CDS gene model=Glyma14g20360 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
GTTGACTGTGATGAGCACAAGAGTTTGTGCAGCAAATATGGAGTCTCTGGGTACCCAACAATTCAGTGGTTTCCAAAAGGATCTCTTGAACCCAAAAAGTATAAAGGGCCACGCACTGCTGATTCACTTGCTGAGTTTGTAAATATGGAAGGAAGAACAAATGTGAAGATTGCTACAGCTCCTTCCAATGTAGTGGTGCTTACATCTGAAAATTTTAATGAGGTTGTCTTAGATGAAACCAAAGATGTCTTG
Predicted protein sequences of Glyma14g20360
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma14g20360.1 sequence type=predicted peptide gene model=Glyma14g20360 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
VDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYKGPRTADSLAEFVNMEGRTNVKIATAPSNVVVLTSENFNEVVLDETKDVL