SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g19985

Feature Type:gene_model
Chromosome:Gm14
Start:22719070
stop:22720224
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g19985
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G31920AT Annotation by Michelle Graham. TAIR10: response regulator 10 | chr4:15444290-15446766 REVERSE LENGTH=552 SoyBaseE_val: 6.00E-55ISS
GO:0000160GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0009736GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0010029GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of seed germination SoyBaseN/AISS
GO:0010380GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chlorophyll biosynthetic process SoyBaseN/AISS
GO:0031537GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of anthocyanin metabolic process SoyBaseN/AISS
GO:0048367GO-bp Annotation by Michelle Graham. GO Biological Process: shoot development SoyBaseN/AISS
GO:0048831GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of shoot development SoyBaseN/AISS
GO:0080022GO-bp Annotation by Michelle Graham. GO Biological Process: primary root development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000156GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphorelay response regulator activity SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PTHR26402Panther RESPONSE REGULATOR OF TWO-COMPONENT SYSTEM JGI ISS
PTHR26402:SF38Panther JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_Q15FC9UniRef Annotation by Michelle Graham. Most informative UniRef hit: SRR391 n=1 Tax=Striga asiatica RepID=Q15FC9_STRAF SoyBaseE_val: 2.00E-61ISS
UniRef100_UPI000233ACE7UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233ACE7 related cluster n=1 Tax=unknown RepID=UPI000233ACE7 SoyBaseE_val: 6.00E-101ISS

Expression Patterns of Glyma14g19985
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g19985 not represented in the dataset
Glyma14g19985 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g19985 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g139500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g19985
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g19985
>Glyma14g19985.1   sequence type=CDS   gene model=Glyma14g19985   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGAGGAAAAACATAAACAAGTTTGACCTTCTTATTAGCGATGTAAATATACCTGACATGGATGGGTTTAAACTTCTTGAGCTAGTGGGACTTCAAATGGACCTACCATTTATTACTAAGATCAAACACTTTGTTATACAGGGTGCTTGTGAGTACTTAACCAAACCAATTCGAATTGAAGAGTTACAAAACATATGGAAACATTTTGCAAATGAGGAGAAAGCTAGCTATATGGCTGGGGAATGCAGTCAAGCCATGGCACCCAAAAATAATACCGACCAGAATATAAAACTGGGTCAAAAAAGGAAGGAACAAAGTGAGGATGAGGAAGAGGAAGAATATCATAAAGAGAATGAGGAACACTTAAATCAAAATAAGCCTCGTTTAGTTTGGGATGTCGAGTTGCATAGGAAATTTCTTGTTGCTGTTGATGATCTAGGAATTGACAAGGCTTTCCCCAAGAGAATACTCGACTTGATGAATGTCGAAGGACTTACAAGAGAAAACGTAGCAAGCCATCTACAGAAATACAAACTCGATCTTAGAAAACCTACTCGGCAGCCTAGCATGGTTGCTAAGTTGGGTAGTAGTGATCCTTGCCTGTAG
Predicted protein sequences of Glyma14g19985
>Glyma14g19985.1   sequence type=predicted peptide   gene model=Glyma14g19985   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLRKNINKFDLLISDVNIPDMDGFKLLELVGLQMDLPFITKIKHFVIQGACEYLTKPIRIEELQNIWKHFANEEKASYMAGECSQAMAPKNNTDQNIKLGQKRKEQSEDEEEEEYHKENEEHLNQNKPRLVWDVELHRKFLVAVDDLGIDKAFPKRILDLMNVEGLTRENVASHLQKYKLDLRKPTRQPSMVAKLGSSDPCL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo