SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g19881

Feature Type:gene_model
Chromosome:Gm14
Start:22495682
stop:22496297
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g19881
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G05630AT Annotation by Michelle Graham. TAIR10: phospholipase D P2 | chr3:1635321-1640105 FORWARD LENGTH=1046 SoyBaseE_val: 2.00E-48ISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0006995GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to nitrogen starvation SoyBaseN/AISS
GO:0007568GO-bp Annotation by Michelle Graham. GO Biological Process: aging SoyBaseN/AISS
GO:0009395GO-bp Annotation by Michelle Graham. GO Biological Process: phospholipid catabolic process SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0016036GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation SoyBaseN/AISS
GO:0019375GO-bp Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process SoyBaseN/AISS
GO:0042631GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0060627GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of vesicle-mediated transport SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004630GO-mf Annotation by Michelle Graham. GO Molecular Function: phospholipase D activity SoyBaseN/AISS
GO:0005543GO-mf Annotation by Michelle Graham. GO Molecular Function: phospholipid binding SoyBaseN/AISS
PTHR18896Panther PHOSPHOLIPASE D JGI ISS
PTHR18896:SF2Panther PHOSPHOLIPASE D ZETA JGI ISS
UniRef100_A2Q157UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phospholipase D/Transphosphatidylase; Pleckstrin-like n=1 Tax=Medicago truncatula RepID=A2Q157_MEDTR SoyBaseE_val: 2.00E-59ISS
UniRef100_UPI000233DE07UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DE07 related cluster n=1 Tax=unknown RepID=UPI000233DE07 SoyBaseE_val: 2.00E-63ISS

Expression Patterns of Glyma14g19881
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g19881 not represented in the dataset
Glyma14g19881 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g19881 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g139200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g19881
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g19881
>Glyma14g19881.1   sequence type=CDS   gene model=Glyma14g19881   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATGCTTTGGTTCCTTTGCTCCCATAAGAGGTTTGACTGAAGATAGGAGCCAAGCCCAATGGTTTGTAGATGGACAGGCAACATTTGAAGCAATTGCTACTTCAATTCAAGATGCAAAGTTAGAGATCTTCATTACGGGTTGGTGGTTGTGCCCAGAGCTATATCTGAGACGGCCTTTTGATAGCTTTTCTACCTCTCGGTTAGATTCATTACTAGAAGAAAAGGCTAACCAAGGGGTTCAAATCTATGTGCTTCTCTACAAGGAGGTTTCTCTAGCTTTAAAAATCAACAACTTGTACAGTATGAGAATACTGTTAAAAATTCATGAGAATGTGAGGATTTAA
Predicted protein sequences of Glyma14g19881
>Glyma14g19881.1   sequence type=predicted peptide   gene model=Glyma14g19881   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MECFGSFAPIRGLTEDRSQAQWFVDGQATFEAIATSIQDAKLEIFITGWWLCPELYLRRPFDSFSTSRLDSLLEEKANQGVQIYVLLYKEVSLALKINNLYSMRILLKIHENVRI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo