SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g18432

Feature Type:gene_model
Chromosome:Gm14
Start:20514322
stop:20516070
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g18432
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20570AT Annotation by Michelle Graham. TAIR10: RING-box 1 | chr5:6956905-6958221 REVERSE LENGTH=142 SoyBaseE_val: 3.00E-22ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0016925GO-bp Annotation by Michelle Graham. GO Biological Process: protein sumoylation SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0042752GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of circadian rhythm SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0051510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0019005GO-cc Annotation by Michelle Graham. GO Cellular Compartment: SCF ubiquitin ligase complex SoyBaseN/AISS
GO:0031463GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Cul3-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR11210Panther RING FINGER JGI ISS
UniRef100_F4K5K0UniRef Annotation by Michelle Graham. Most informative UniRef hit: RING-box protein 1 n=1 Tax=Arabidopsis thaliana RepID=F4K5K0_ARATH SoyBaseE_val: 1.00E-19ISS
UniRef100_I1LRR7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LRR7_SOYBN SoyBaseE_val: 1.00E-21ISS

Expression Patterns of Glyma14g18432
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g18432 not represented in the dataset
Glyma14g18432 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g18432 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g137600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g18432
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g18432
>Glyma14g18432.1   sequence type=CDS   gene model=Glyma14g18432   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACACTGGATTCCGACGTGATCGTGTTTCCAGCCGGTGAAGCCTCCAGCAGCGGTGATATTGTCATGGATAATTCTGCTATTTGTCGGAACCATATCATGGATCTCTGTATTGAGTGTCAGGCCAACCAAGCTAGCACCACTAGCGAGGAATGCACTGTAGCTTGGGAGTTTGTAACCATGCTTTTCACTTCCATTGCATAA
Predicted protein sequences of Glyma14g18432
>Glyma14g18432.1   sequence type=predicted peptide   gene model=Glyma14g18432   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATLDSDVIVFPAGEASSSGDIVMDNSAICRNHIMDLCIECQANQASTTSEECTVAWEFVTMLFTSIA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo