Glyma14g18414 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g18414): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g18414): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g18414

Feature Type:	gene_model
Chromosome:	Gm14
Start:	20513617
stop:	20513911
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g18414

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G22475	AT	Annotation by Michelle Graham. TAIR10: GRAM domain family protein \| chr2:9541523-9544242 FORWARD LENGTH=248	SoyBase	E_val: 1.00E-40	ISS
GO:0010026	GO-bp	Annotation by Michelle Graham. GO Biological Process: trichome differentiation	SoyBase	N/A	ISS
GO:0010482	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of epidermal cell division	SoyBase	N/A	ISS
GO:0042732	GO-bp	Annotation by Michelle Graham. GO Biological Process: D-xylose metabolic process	SoyBase	N/A	ISS
GO:0048765	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation	SoyBase	N/A	ISS
GO:0051567	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF02893	PFAM	GRAM domain	JGI		ISS
UniRef100_G7J579	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GLABRA2 expression modulator n=1 Tax=Medicago truncatula RepID=G7J579_MEDTR	SoyBase	E_val: 1.00E-46	ISS
UniRef100_UPI000233EAF6	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233EAF6 related cluster n=1 Tax=unknown RepID=UPI000233EAF6	SoyBase	E_val: 7.00E-50	ISS

Expression Patterns of Glyma14g18414

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g18414 not represented in the dataset	Glyma14g18414 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g18414 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g137500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g18414

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g18414

Limit To All Plant Sequences

>Glyma14g18414.1   sequence type=CDS   gene model=Glyma14g18414   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAAATGGGACCTAGTTTTGTTGATGTTGTCGTGGGGAGGATTACTCAAGGAACTAAGGTTCTTGCAGAAAGAGGGTATGAAAAGATCTTTAGGCAAACATTTGAGATAGTTCCAGAGGAGCAGCTTCTCAAAACTTATGCATGCTACTTGTCTACCTCGGCTAGACCTGTGATGGGAGTCTTATATTTGTCAACAACTAAGCTGGCATTTTGTAGTGATAACCCACTTTCTTACCAAGTGGGTGACCAGACTCAATAG

Predicted protein sequences of Glyma14g18414

Limit To All Plant Sequences

>Glyma14g18414.1   sequence type=predicted peptide   gene model=Glyma14g18414   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KMGPSFVDVVVGRITQGTKVLAERGYEKIFRQTFEIVPEEQLLKTYACYLSTSARPVMGVLYLSTTKLAFCSDNPLSYQVGDQTQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain