Glyma14g18397 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g18397

Feature Type:	gene_model
Chromosome:	Gm14
Start:	20497053
stop:	20509193
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g18397

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G28050	AT	Annotation by Michelle Graham. TAIR10: nodulin MtN21 /EamA-like transporter family protein \| chr3:10442984-10445216 FORWARD LENGTH=367	SoyBase	E_val: 3.00E-36	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
PF00892	PFAM	EamA-like transporter family	JGI		ISS
UniRef100_B9RUD0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 5NG4, putative n=1 Tax=Ricinus communis RepID=B9RUD0_RICCO	SoyBase	E_val: 8.00E-44	ISS
UniRef100_I1MIH0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MIH0_SOYBN	SoyBase	E_val: 2.00E-102	ISS

Expression Patterns of Glyma14g18397

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g18397 not represented in the dataset	Glyma14g18397 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g18397 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g18397

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g18397

Limit To All Plant Sequences

>Glyma14g18397.1   sequence type=CDS   gene model=Glyma14g18397   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CATGTCTTTGTTGCTTATACTTCTGCTGTTGCTACCACTCTACTCTTTCCTATCAATTTTTTTAGTAGAAGATCAAGAGTGGTTCCTCCACTTAGTTTCTCCATAGCATCCAAAATCATTCTCATTGGGATGATTGGAACCTCATGTCAGATAATGTATTATGTTGGAGTTAGCTACAGTTCTACAACACTTGCTTCATCAATCGCCAATCTGGAACCTGCTTTCACCTTCATTCTTGCCATCATTTTCAGGATGGAAAAGATAGCTGCCAAAAGCAGAAGTAGTCAAGCTAAGGTAATTGGAAGCATAATATCAATAGTAGGAGCATTTGTATTGACTTTGTACAAAAGCCCTTCAATCATCAAAGCTCATTCCCATGATCTTTCCTTACCACTTCAACAACCATTTAGCTTTCTTAAATCTGGGGATGCAGATTGGGTCACTGCTGGCACATGCTTGGAAAGTAGGACTGAATATTTCATTAATCTCCATTGTTTGCACTGTAAGATACCTTTCTAA

Predicted protein sequences of Glyma14g18397

Limit To All Plant Sequences

>Glyma14g18397.1   sequence type=predicted peptide   gene model=Glyma14g18397   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
HVFVAYTSAVATTLLFPINFFSRRSRVVPPLSFSIASKIILIGMIGTSCQIMYYVGVSYSSTTLASSIANLEPAFTFILAIIFRMEKIAAKSRSSQAKVIGSIISIVGAFVLTLYKSPSIIKAHSHDLSLPLQQPFSFLKSGDADWVTAGTCLESRTEYFINLHCLHCKIPF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain