SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g18035

Feature Type:gene_model
Chromosome:Gm14
Start:20220374
stop:20223750
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g18035
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G09795AT Annotation by Michelle Graham. TAIR10: ATP phosphoribosyl transferase 2 | chr1:3173588-3176690 FORWARD LENGTH=413 SoyBaseE_val: 3.00E-100ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0000105GO-bp Annotation by Michelle Graham. GO Biological Process: histidine biosynthetic process SoyBaseN/AISS
GO:0006567GO-bp Annotation by Michelle Graham. GO Biological Process: threonine catabolic process SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0000287GO-mf Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding SoyBaseN/AISS
GO:0003879GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP phosphoribosyltransferase activity SoyBaseN/AISS
PTHR21403Panther ATP PHOSPHORIBOSYLTRANSFERASE (ATP-PRTASE) JGI ISS
PF01634PFAM ATP phosphoribosyltransferase JGI ISS
UniRef100_G7JFL4UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATP phosphoribosyltransferase n=3 Tax=Medicago truncatula RepID=G7JFL4_MEDTR SoyBaseE_val: 9.00E-105ISS
UniRef100_I1JPH8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JPH8_SOYBN SoyBaseE_val: 1.00E-117ISS

Expression Patterns of Glyma14g18035
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g18035 not represented in the dataset
Glyma14g18035 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g18035 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g136800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g18035
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g18035
>Glyma14g18035.1   sequence type=CDS   gene model=Glyma14g18035   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGGCCCAAATACATCACAAGAAAATTGTTATCTGGAGATCTTGACCTTGGAATTGTTGGACTCGATACTTTCAATGAACATGGCCAGGGTAGTGAAGATCTTATCATTATCCATGAGGCTCTTGAGTATGGTGATTGTCATTTATCCGTTGCAATTCCCCAATATGGAATATTTGAAAATGTAAATTCAATGGACAAGCTTGCAAAAATGCCTCAATGGACAGAAGAAAAGCCTCTACGAGTTGCTATCGGTTTCACCTATGTAAGGCCTAAATTTATGAAAGAGAATGGACTTAAGCATGTCACATTTTCAACTGCTGATGGAGCACAGGAGGCAGCTCCTGCGATGGGGATAGCTGATGCTATCTTGGACATTGTAAGTAATGGGACCACACTGAGAGAAAACAACTTGAAGGAAATCAAAGGAGGAGTTGTTTTGGAAAGCCAGGTTGTGTTTATTGCAAGCAGGAAATCGATGATCCAACAAAAAGGAGTACTTGAAACAACACAAGAGATGCTTGAGAGGTTGGAAGCACATCTGAGGGCCATTGGGTAA
Predicted protein sequences of Glyma14g18035
>Glyma14g18035.1   sequence type=predicted peptide   gene model=Glyma14g18035   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
RPKYITRKLLSGDLDLGIVGLDTFNEHGQGSEDLIIIHEALEYGDCHLSVAIPQYGIFENVNSMDKLAKMPQWTEEKPLRVAIGFTYVRPKFMKENGLKHVTFSTADGAQEAAPAMGIADAILDIVSNGTTLRENNLKEIKGGVVLESQVVFIASRKSMIQQKGVLETTQEMLERLEAHLRAIG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo