SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g17863): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g17863): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g17863

Feature Type:gene_model
Chromosome:Gm14
Start:19931432
stop:19937024
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g17863
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G09150AT Annotation by Michelle Graham. TAIR10: phytochromobilin:ferredoxin oxidoreductase, chloroplast / phytochromobilin synthase (HY2) | chr3:2803665-2805333 FORWARD LENGTH=329 SoyBaseE_val: 3.00E-15ISS
GO:0010019GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast-nucleus signaling pathway SoyBaseN/AISS
GO:0010024GO-bp Annotation by Michelle Graham. GO Biological Process: phytochromobilin biosynthetic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016636GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors, iron-sulfur protein as acceptor SoyBaseN/AISS
GO:0050619GO-mf Annotation by Michelle Graham. GO Molecular Function: phytochromobilin:ferredoxin oxidoreductase activity SoyBaseN/AISS
GO:0050897GO-mf Annotation by Michelle Graham. GO Molecular Function: cobalt ion binding SoyBaseN/AISS
UniRef100_G7KEL5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phytochromobilin:ferredoxin oxidoreductase n=1 Tax=Medicago truncatula RepID=G7KEL5_MEDTR SoyBaseE_val: 6.00E-24ISS
UniRef100_UPI000233BF6FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BF6F related cluster n=1 Tax=unknown RepID=UPI000233BF6F SoyBaseE_val: 4.00E-97ISS

Expression Patterns of Glyma14g17863
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g17863 not represented in the dataset
Glyma14g17863 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g17863 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g136300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g17863
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g17863
>Glyma14g17863.1   sequence type=CDS   gene model=Glyma14g17863   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACAAGTACTTTCTTTTCACTATACATGAGTTTGTTAATGAGATAATAATGAAAATTCACAACTCTTGGTCTTTAAAAGCGATAGTCAGTTTTACTTGTGCCTTGAGGAGGAGGAGGAGTAATTTTATACCAAGTTGTTCAGTATCTTATCTAAAGTTTGTTGAGTTTGCTTTGGATGAAACCAAACGTCACACTCACTTGATCCCTTCGCCTTTACAGGAAAAGTTCAGTTTCATGAATTCCAAGGATGTTAAAGGGAGTCTTAGTATGCTATCATTTGAAGCTACAAAAATTAGGCTTCTACGAAGATTGATCATTGAGACAGAAACAATGCAAGTGGTTTTTTTAATGCCCATCAATTATCAAATTGATATATGGTTGGTATCTACTAGTGTCTTAACAAAATATGCCTTTGTGTAG
Predicted protein sequences of Glyma14g17863
>Glyma14g17863.1   sequence type=predicted peptide   gene model=Glyma14g17863   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYKYFLFTIHEFVNEIIMKIHNSWSLKAIVSFTCALRRRRSNFIPSCSVSYLKFVEFALDETKRHTHLIPSPLQEKFSFMNSKDVKGSLSMLSFEATKIRLLRRLIIETETMQVVFLMPINYQIDIWLVSTSVLTKYAFV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo