|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT2G44420 | AT | Annotation by Michelle Graham. TAIR10: protein N-terminal asparagine amidohydrolase family protein | chr2:18330568-18332696 FORWARD LENGTH=347 | SoyBase | E_val: 1.00E-20 | ISS |
GO:0006499 | GO-bp | Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation | SoyBase | N/A | ISS |
GO:0007165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: signal transduction | SoyBase | N/A | ISS |
GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
GO:0009755 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hormone-mediated signaling pathway | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0008418 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein-N-terminal asparagine amidohydrolase activity | SoyBase | N/A | ISS |
UniRef100_G7IJ12 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Protein N-terminal asparagine amidohydrolase n=1 Tax=Medicago truncatula RepID=G7IJ12_MEDTR | SoyBase | E_val: 2.00E-27 | ISS |
UniRef100_I1KTH9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KTH9_SOYBN | SoyBase | E_val: 3.00E-37 | ISS |
Glyma14g17821 not represented in the dataset |
Glyma14g17821 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.14g136100 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g17821.1 sequence type=CDS gene model=Glyma14g17821 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCTTATGAAGATGCTAACTGGAACGGAAAGTTACTAGAAACATATGATTGTGGCATTGACTATTTCAAAATCTCTCCTTGTCGCTGGACTCTTCGCCAAAATCATATTGCTTCATCACTTCTGAACTATTCTGATTCCGAAATTCTTTCAATCTGTTCTACATCACCTACTGCTGAAGCCCCAGATTTTGTGGAGAATTTAAAAAGGTAA
>Glyma14g17821.1 sequence type=predicted peptide gene model=Glyma14g17821 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSYEDANWNGKLLETYDCGIDYFKISPCRWTLRQNHIASSLLNYSDSEILSICSTSPTAEAPDFVENLKR*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||